Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus laevis D (1A) dopamine receptor

This Recombinant Xenopus laevis D (1A) dopamine receptor spans the amino acid sequence from region 1-451.

Product Specifications

Product Name Alternative

D (1A) dopamine receptor, Dopamine D1 receptor

UniProt

P42289

Expression Region

1-451

Origin

Xenopus laevis (African clawed frog)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTFNITSMDEDVLLTERESSFRVLTGCFLSVLILSTLLGNTLVCAAVIRFRHLRSKVTNF FVISLAVSDLLVAVLVMPWKAVAEIAGFWPFGTFCNIWVAFDIMCSTASILNLCVISVDR YWAISSPFRYERKMTPKVAFIMIGVAWTLSVLISFIPVQLNWHKAKTTSFFDLNITLHDR TMDNCDSSLNRTYAISSSLISFYIPVAIMIVTYTRIYRIAAKQIRRISALERAAVHAKNC QNSTSNRNSLDCQQPESSLKTSFKRETKVLKTLSVIMGVFVCCWLPFFILNCIVPFCDPS LTTSGTEPFCISSTTFDVFVWFGWANSSLNPIIYAFNADFRKAFSNLLGCYRLCPTSNNI IETVSINNNGAVVYSCQQEPKGSIPNECNLVYLIPHAIICPEDEVLKKEDESGLSKSLEK MSPAFSGILDYDADVSLEKINPITQNGQPKT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human DKK4 activation kit by CRISPRa
GA109018 1 Kit

Human DKK4 activation kit by CRISPRa

Sign In for Pricing
View Details
HSD11B1L Human Gene Knockout Kit (CRISPR)
KN421286 1 Kit

HSD11B1L Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CheetahTM PEA-PLEX HotStart Taq (5 U/uL, Enzyme Only)
#29138-1ML 1x 1 mL

CheetahTM PEA-PLEX HotStart Taq (5 U/uL, Enzyme Only)

Sign In for Pricing
View Details
Gasdermin like (GSDMB) Human Gene Knockout Kit (CRISPR)
KN419044 1 Kit

Gasdermin like (GSDMB) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cell Meter™ Annexin V Binding Apoptosis Assay Kit *Blue Fluorescence Excited at 405 nm*
22828-AAT 100 Tests

Cell Meter™ Annexin V Binding Apoptosis Assay Kit *Blue Fluorescence Excited at 405 nm*

Sign In for Pricing
View Details
Suppressor of Fused (SUFU) Human Gene Knockout Kit (CRISPR)
KN401021 1 Kit

Suppressor of Fused (SUFU) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details