Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus laevis D (1A) dopamine receptor

This Recombinant Xenopus laevis D (1A) dopamine receptor spans the amino acid sequence from region 1-451.

Product Specifications

Product Name Alternative

D (1A) dopamine receptor, Dopamine D1 receptor

UniProt

P42289

Expression Region

1-451

Origin

Xenopus laevis (African clawed frog)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTFNITSMDEDVLLTERESSFRVLTGCFLSVLILSTLLGNTLVCAAVIRFRHLRSKVTNF FVISLAVSDLLVAVLVMPWKAVAEIAGFWPFGTFCNIWVAFDIMCSTASILNLCVISVDR YWAISSPFRYERKMTPKVAFIMIGVAWTLSVLISFIPVQLNWHKAKTTSFFDLNITLHDR TMDNCDSSLNRTYAISSSLISFYIPVAIMIVTYTRIYRIAAKQIRRISALERAAVHAKNC QNSTSNRNSLDCQQPESSLKTSFKRETKVLKTLSVIMGVFVCCWLPFFILNCIVPFCDPS LTTSGTEPFCISSTTFDVFVWFGWANSSLNPIIYAFNADFRKAFSNLLGCYRLCPTSNNI IETVSINNNGAVVYSCQQEPKGSIPNECNLVYLIPHAIICPEDEVLKKEDESGLSKSLEK MSPAFSGILDYDADVSLEKINPITQNGQPKT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nerve Terminal Staining Kit IIB
#70031-1 1 Kit

Nerve Terminal Staining Kit IIB

Sign In for Pricing
View Details
DNase I (DNASE1) (NM_005223) Human Over-expression Lysate
LC401601 20 µg

DNase I (DNASE1) (NM_005223) Human Over-expression Lysate

Sign In for Pricing
View Details
Human CASS4 activation kit by CRISPRa
GA111362 1 Kit

Human CASS4 activation kit by CRISPRa

Sign In for Pricing
View Details
Anti-FREE1 | Protein FREE1
AS22 4702 50 µg

Anti-FREE1 | Protein FREE1

Sign In for Pricing
View Details
MerTK (Innate Immune Checkpoint) (MERTK/3022), CF594 conjugate, 0.1mg/mL
BNC943022-500 1x 500 µL

MerTK (Innate Immune Checkpoint) (MERTK/3022), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Acyloxyacyl Hydrolase (AOAH) (NM_001177506) Human Over-expression Lysate
LY433429 100 µg

Acyloxyacyl Hydrolase (AOAH) (NM_001177506) Human Over-expression Lysate

Sign In for Pricing
View Details