Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Alpha-2A adrenergic receptor (ADRA2A)

This Recombinant Bovine Alpha-2A adrenergic receptor (ADRA2A) spans the amino acid sequence from region 1-452.

Product Specifications

Product Name Alternative

Alpha-2A adrenergic receptor, Alpha-2A adrenoreceptor, Alpha-2A adrenoceptor, Alpha-2AAR, Alpha-2D adrenergic receptor

UniProt

Q28838

Expression Region

1-452

Origin

Bos taurus (Bovine)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGSLQPDAGNASWNGTEAPGGGARATPYSLQVTLTLVCLAGLLMLFTVFGNVLVIIAVFT SRALKAPQNLFLVSLASADILVATLVIPFSLANEVMGYWYFGKAWCEIYLALDVLFCTSS IVHLCAISLDRYWSITQAIEYNLKRTPRRIKAIIVTVWVISAVISFPPLISFEKKRGRSG QPSAEPRCEINDQKWYVISSSIGSFFAPCLIMILVYVRIYQIAKRRTRVPPSRRGPDATA AELPGSAERRPNGLGPERGGVGPVGAEVESLQVQLNGAPGEPAPAGAGADALDLEESSSS EHAERPPGSRRSERGPRAKGKARASQVKPGDSLPRRGPGATGLGAPTAGPAEERSGGGAK ASRWRGRQNREKRFTFVLAVVIGVFVVCWFPFFFTYTLTAIGCPVPPTLFKFFFWFGYCN SSLNPVIYTIFNHDFRRAFKKILCRGDRKRIV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ku70 (XRCC6) Rabbit Polyclonal Antibody
TA362515 100 µL

Ku70 (XRCC6) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PTEN (Tumor Suppressor Oncoprotein) (PTEN/2110), CF647 conjugate, 0.1mg/mL
BNC472110-100 1x 100 µL

PTEN (Tumor Suppressor Oncoprotein) (PTEN/2110), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TFPI Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2B10]
TA806093AM 100 µL

TFPI Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2B10]

Sign In for Pricing
View Details
DENND2C Human qPCR Primer Pair (NM_198459)
HP219324 200 Reactions

DENND2C Human qPCR Primer Pair (NM_198459)

Sign In for Pricing
View Details
MED28 Mouse Monoclonal Antibody [Clone ID: OTI10C8]
CF810134 100 µg

MED28 Mouse Monoclonal Antibody [Clone ID: OTI10C8]

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS712962 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details