Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Neuromedin-K receptor (Tacr3)

This Recombinant Mouse Neuromedin-K receptor (Tacr3) spans the amino acid sequence from region 1-452.

Product Specifications

Product Name Alternative

Neuromedin-K receptor, NKR, NK-3 receptor, NK-3R, Neurokinin B receptor, Tachykinin receptor 3

UniProt

P47937

Expression Region

1-452

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASVPTGENWTDGTAGVGSHTGNLSAALGITEWLALQAGNFSSALGLPVTSQAPSQVRAN LTNQFVQPSWRIALWSLAYGLVVAVAVFGNLIVIWIILAHKRMRTVTNYFLVNLAFSDAS VAAFNTLVNFIYGVHSEWYFGANYCRFQNFFPITAVFASIYSMTAIAVDRYMAIIDPLKP RLSATATKIVIGSIWILAFLLAFPQCLYSKIKVMPGRTLCYVQWPEGPKQHFTYHIIVII LVYCFPLLIMGVTYTIVGITLWGGEIPGDTCDKYHEQLKAKRKVVKMMIIVVVTFAICWL PYHVYFILTAIYQQLNRWKYIQQVYLASFWLAMSSTMYNPIIYCCLNKRFRAGFKRAFRW CPFIQVSSYDELELKTTRFHPTRQSSLYTVSRMESVTVLYDPSEGDPAKSSRKKRAVPRD PSANGCSHREFKSASTTSSFISSPYTSVDEYS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Complement C4d (C4D204), CF640R conjugate, 0.1mg/mL
BNC400204-500 1x 500 µL

Complement C4d (C4D204), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF405S conjugate, 0.1mg/mL
BNC040460-100 1x 100 µL

CD44 Standard (156-3C11), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF568 conjugate, 0.1mg/mL
BNC680158-500 1x 500 µL

Cytokeratin 17 (E3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BCL10 (MALT-Lymphoma Marker) (151), CF568 conjugate, 0.1mg/mL
BNC681852-500 1x 500 µL

BCL10 (MALT-Lymphoma Marker) (151), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TLE1 (Synovial Sarcoma Marker) (TLE1/2062), CF647 conjugate, 0.1mg/mL
BNC472062-500 1x 500 µL

TLE1 (Synovial Sarcoma Marker) (TLE1/2062), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Spectrin Alpha 1 (Erythrocyte Marker) (SPTA1/2939R), CF740 conjugate, 0.1mg/mL
BNC742939-100 1x 100 µL

Spectrin Alpha 1 (Erythrocyte Marker) (SPTA1/2939R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details