Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rabbit Gastrin/cholecystokinin type B receptor (CCKBR)

This Recombinant Rabbit Gastrin/cholecystokinin type B receptor (CCKBR) spans the amino acid sequence from region 1-452.

Product Specifications

Product Name Alternative

Gastrin/cholecystokinin type B receptor, CCK-B receptor, CCK-BR, Cholecystokinin-2 receptor, CCK2-R

UniProt

P46627

Expression Region

1-452

Origin

Oryctolagus cuniculus (Rabbit)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELVKLNRSVQGSGPVASLCRPGGPLLNNSGTGNLSCEPPRIRGAGTRELELAIRVTLYA VIFLMSVGGNILIIVVLGLSRRLRTVTNAFLLSLAVSDLLLAVACMPFTLLPNLMGTFIF GTVICKAVSYLMGVSVSVSTLSLVAIALERYSAICRPLQARVWQTRSHAARVILATWLLS GLLMVPYPVYTAVQPVGPRVLQCVHRWPSARVRQTWSVLLLLLLFFVPGVVMAVAYGLIS RELYLGLRFDSDSDSESQSRVRGQGGLPGGAAPGPVHQNGRCRPEAGLAGEDGDGCYVQL PRSRPALELSALTAPISGPGPGPRPAQAKLLAKKRVVRMLLVIVVLFFMCWLPVYSANTW RAFDGPGAHRALSGAPISFIHLLSYASACVNPLVYCFMHRRFRQACLDTCARCCPRPPRA RPRPLPDEDPPTPSIASLSRLSYTTISTLGPG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD59 (heavy chain of Protectin) (BRA-10G), CF488A conjugate, 0.1mg/mL
BNC880181-100 1x 100 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (SX53G8), CF640R conjugate, 0.1mg/mL
BNC400669-100 1x 100 µL

P27 / KIP1 (SX53G8), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Neurofilament (NF-L) (Neuronal Marker) (NEFL/2983R), CF568 conjugate, 0.1mg/mL
BNC682983-500 1x 500 µL

Neurofilament (NF-L) (Neuronal Marker) (NEFL/2983R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (Fn-3), CF405S conjugate, 0.1mg/mL
BNC042848-100 1x 100 µL

Fibronectin (Fn-3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RA (158-4D3), CF568 conjugate, 0.1mg/mL
BNC680028-500 1x 500 µL

CD45RA (158-4D3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EGFR (Epidermal Growth Factor Receptor) (GFR/2968R), CF647 conjugate, 0.1mg/mL
BNC472968-100 1x 100 µL

EGFR (Epidermal Growth Factor Receptor) (GFR/2968R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details