Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human G-protein coupled receptor 39 (GPR39)

This Recombinant Human G-protein coupled receptor 39 (GPR39) spans the amino acid sequence from region 1-453.

Product Specifications

Product Name Alternative

G-protein coupled receptor 39

UniProt

O43194

Expression Region

1-453

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASPSLPGSDCSQIIDHSHVPEFEVATWIKITLILVYLIIFVMGLLGNSATIRVTQVLQK KGYLQKEVTDHMVSLACSDILVFLIGMPMEFYSIIWNPLTTSSYTLSCKLHTFLFEACSY ATLLHVLTLSFERYIAICHPFRYKAVSGPCQVKLLIGFVWVTSALVALPLLFAMGTEYPL VNVPSHRGLTCNRSSTRHHEQPETSNMSICTNLSSRWTVFQSSIFGAFVVYLVVLLSVAF MCWNMMQVLMKSQKGSLAGGTRPPQLRKSESEESRTARRQTIIFLRLIVVTLAVCWMPNQ IRRIMAAAKPKHDWTRSYFRAYMILLPFSETFFYLSSVINPLLYTVSSQQFRRVFVQVLC CRLSLQHANHEKRLRVHAHSTTDSARFVQRPLLFASRRQSSARRTEKIFLSTFQSEAEPQ SKSQSLSLESLEPNSGAKPANSAAENGFQEHEV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Brain Natriuretic Peptide (BNP) ELISA Kit
MBS269586-01 48 Well

Goat Brain Natriuretic Peptide (BNP) ELISA Kit

Sign In for Pricing
View Details
Goat Brain Natriuretic Peptide (BNP) ELISA Kit
MBS269586-02 96 Well

Goat Brain Natriuretic Peptide (BNP) ELISA Kit

Sign In for Pricing
View Details
Goat Brain Natriuretic Peptide (BNP) ELISA Kit
MBS269586-03 5x 96 Well

Goat Brain Natriuretic Peptide (BNP) ELISA Kit

Sign In for Pricing
View Details
Goat Brain Natriuretic Peptide (BNP) ELISA Kit
MBS269586-04 10x 96 Well

Goat Brain Natriuretic Peptide (BNP) ELISA Kit

Sign In for Pricing
View Details
Rat Glucuronidase Beta (GUSb) ELISA Kit
MBS452134-01 48 Tests

Rat Glucuronidase Beta (GUSb) ELISA Kit

Sign In for Pricing
View Details
Rat Glucuronidase Beta (GUSb) ELISA Kit
MBS452134-02 96 Tests

Rat Glucuronidase Beta (GUSb) ELISA Kit

Sign In for Pricing
View Details