Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Putative neuropeptide Y receptor 11 (npr-11)

This Recombinant Putative neuropeptide Y receptor 11 (npr-11) spans the amino acid sequence from region 1-455.

Product Specifications

Product Name Alternative

Putative neuropeptide Y receptor 11, NPY-R

UniProt

Q18179

Expression Region

1-455

Origin

Caenorhabditis elegans

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGSVNESCDNYVEIFNKINYFFRDDQVINGTEYSPKEFGYFITFAYMLIILFGAIGNFLT IIVVILNPAMRTTRNFFILNLALSDFFVCIVTAPTTLYTVLYMFWPFSRTLCKIAGSLQG FNIFLSTFSIASIAVDRYVLIIFPTKRERQQNLSFCFFIMIWVISLILAVPLLQASDLTP VFVEPSCDLALYICHEQNEIWEKMIISKGTYTLAVLITQYAFPLFSLVFAYSRIAHRMKL RFANRNQNVTTNTNTSQRRRSVVERQRRTHLLLVCVVAVFAVAWLPLNVFHIFNTFELVN SFSVTTFSICHCLAMCSACLNPLIYAFFNHNFRIEFMHLFDRVGLRSLRVVIFGEQESLK KSMRTEFRSRGGCKTVTTAEPATFQRMNESMILSAMEQDEQLSSGGKLFVLKKYILKMFQ KGGHKQSTPASPRLGFGYNSIMTSELFSIVEGVLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD71 (66IG10), CF488A conjugate, 0.1mg/mL
BNC880871-100 1x 100 µL

CD71 (66IG10), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (SC05), CF488A conjugate, 0.1mg/mL
BNC880050-100 1x 100 µL

IgA Secretory Component (SC05), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF568 conjugate, 0.1mg/mL
BNC680342-500 1x 500 µL

CD43 (84-3C1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Vitronectin Receptor / CD51 / CD61 (23C6), CF488A conjugate, 0.1mg/mL
BNC881471-500 1x 500 µL

Vitronectin Receptor / CD51 / CD61 (23C6), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cyclin A2 (E67), CF647 conjugate, 0.1mg/mL
BNC470673-500 1x 500 µL

Cyclin A2 (E67), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (ICAM3/1019), CF488A conjugate, 0.1mg/mL
BNC881019-100 1x 100 µL

CD50 (ICAM-3) (ICAM3/1019), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details