Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Endothelin B receptor-like protein 2 (GPR37L1)

This Recombinant Bovine Endothelin B receptor-like protein 2 (GPR37L1) spans the amino acid sequence from region 26-482.

Product Specifications

Product Name Alternative

Endothelin B receptor-like protein 2, ETBR-LP-2, G-protein coupled receptor 37-like 1

UniProt

Q17QD8

Expression Region

26-482

Origin

Bos taurus (Bovine)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

VWLQQGGHQPVAQEQPDRSRRGAEREDAKGLQQYVPEGWAEYPRPIRPAALQPTQPWVAA SPSPDRARATGGSGQEPQGNVTGPPGQRPQVQNPLYPVTERSYGAYAVLLLALLLFAVGI VGSLAVMCIVWHSYYLKSAWNSVLASLALWDFLVLFFCLPVVTFHEITKQRLLGAVSCRA VPFVEVSSLGVTTFSLCALGIDRFHVATSTLPKARPIEPCPSILAKLAVIWVGSMTLAAP ELLLWQLVREPSPAAGTVDTCIMKPSAHLPESLYSLVLTYQNARMWWSFGCYFCLPVLFT VTCQLVTWRVRGTPGRKPESRPGPQEPRGARPSSTVAGLAAVHALCALPENVCNVVAAYL SAALTRQTLELLGLVTQFSTFFKAALTPLLLLCVSRPLGRAFLDCCCCCCGEGCGEGCGG RAAPAGPRAKLHTELSASGYFHKPREAPPLLALGTPC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD106 / VCAM1 (B-K9), CF568 conjugate, 0.1mg/mL
BNC680304-500 1x 500 µL

CD106 / VCAM1 (B-K9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (WA-1), CF405S conjugate, 0.1mg/mL
BNC040043-100 1x 100 µL

P21 / WAF1 (WA-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF594 conjugate, 0.1mg/mL
BNC940003-100 1x 100 µL

CD45RO (UCHL-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF594 conjugate, 0.1mg/mL
BNC940437-500 1x 500 µL

CD47 (B6H12.2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T3-3A1), CF405S conjugate, 0.1mg/mL
BNC040978-100 1x 100 µL

CD7 (T3-3A1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF555 conjugate, 0.1mg/mL
BNC550333-100 1x 100 µL

CD8 (RIV11), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details