Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Probable G-protein coupled receptor 135 (Gpr135)

This Recombinant Mouse Probable G-protein coupled receptor 135 (Gpr135) spans the amino acid sequence from region 1-457.

Product Specifications

Product Name Alternative

Probable G-protein coupled receptor 135

UniProt

Q7TQP2

Expression Region

1-457

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEEQARPPGRPAASATLQGSAHPGGAASTATAAALSFSSVATVTLGNQSDAGRPEAAGSR GPAPLLWHGAAVAAQALVLLLIFLLSSLGNCAVMGVIVKHRQLRTVTNAFILSLSLSDLL TALLCLPAAFLDLFAPPGDSGPWRSFCAASRFFSSCFGIVSTFSVALISLDRYCAIVRPP RDKLGRRRALQLLAGAWLAALGFSLPWDLLRAPREPPAPQSFHRCLYRTSPDPAQLGVAY SVGLVVACYLLPFLLMCFCRYHICKTVRLSDVRVRPMTTYARVLRFFSEVRTATTVLIMI IFVMCCWGPYCFLVLLAATRQGQATQAPSLLNVAAVWLTWANGAINPVIYAIRNPNISML LGRNREEGYRTRNMDAFLPSQGLGFQARSRNRLRNGCANRLGACSRMPSSNPASGSGGEV VMWARKNPVVLFFREGPPDSVMEVGKLHNSETRDSSI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Colon: right
CS627734 5x 5 µm

Frozen Tissue Sections, Colon: right

Sign In for Pricing
View Details
AFF4 Human Gene Knockout Kit (CRISPR)
KN417692 1 Kit

AFF4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Atp8a1 activation kit by CRISPRa
GA200340 1 Kit

Mouse Atp8a1 activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue Total RNA, Thyroid gland
CR560606 5 µg

Tissue Total RNA, Thyroid gland

Sign In for Pricing
View Details
CDCF [5- (and-6) -Carboxy-2',7'-dichlorofluorescein] *Mixed isomers*
235-AAT 100 mg

CDCF [5- (and-6) -Carboxy-2',7'-dichlorofluorescein] *Mixed isomers*

Sign In for Pricing
View Details
PP1C gamma (PPP1CC) (Isoform gamma-2) Sheep Polyclonal Antibody
AP05038PU-N 100 µg

PP1C gamma (PPP1CC) (Isoform gamma-2) Sheep Polyclonal Antibody

Sign In for Pricing
View Details