Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Anopheles gambiae Gustatory and odorant receptor 24 (GPRgr24)

This Recombinant Anopheles gambiae Gustatory and odorant receptor 24 (GPRgr24) spans the amino acid sequence from region 1-457.

Product Specifications

Product Name Alternative

Gustatory and odorant receptor 24

UniProt

Q7PYF4

Expression Region

1-457

Origin

Anopheles gambiae (African malaria mosquito)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLYFNADTMRIERSSVHEPKRNRNVFLDVKPIADDANVNVPPRQAARRNATVFNNRVGF PPLTPKEAFVDAVPADQTCMVFESSKPIYLVLRAIGVLPYTRLPSGGTAFVLASPSMTYC VLFFLLLTVYIAFILLNRIEIVRTLEGRFEESVIAYLFIVNILPILIIPLMWYESRKVVS VVNGWVDFETVYRETTGRALELRLRTKAQVIAILLPILCSLSVAITHVTMVDFKLLQVIP YCVLDTITYMMGGYWYMACETLSITAKILAEDFQRALRHVGPAAKVSEYRSLWLRLSKLA RDTGFSTCYTFTFICLYLFFIITLSIYGLMSQISDGFGVKDIGLAVTAFCSVGLLFYICD EAHYASFNVRTNFQKKLLMVELSWMNTDAQTEINMFLRATEMNPSSINLGGFFDVNRTLF KSLLATMVTYLVVLLQFQISIPDEPSAMLMHSNSSHS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11c (HC1/1), CF740 conjugate, 0.1mg/mL
BNC740152-100 1x 100 µL

CD11c (HC1/1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF405S conjugate, 0.1mg/mL
BNC040152-500 1x 500 µL

CD11c (HC1/1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF405S conjugate, 0.1mg/mL
BNC041035-100 1x 100 µL

CD8 (C8/1035), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Renal Cell Carcinoma (Carbonic Anhydrase IX) (PN-15), CF640R conjugate, 0.1mg/mL
BNC400637-500 1x 500 µL

Renal Cell Carcinoma (Carbonic Anhydrase IX) (PN-15), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Neurofilament (NF-H) (NF421), CF640R conjugate, 0.1mg/mL
BNC400421-100 1x 100 µL

Neurofilament (NF-H) (NF421), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PTH (Parathyroid Hormone) (N & C Terminal) (3H9 + PTH/1175), CF594 conjugate, 0.1mg/mL
BNC941236-500 1x 500 µL

PTH (Parathyroid Hormone) (N & C Terminal) (3H9 + PTH/1175), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details