Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Probable G-protein coupled receptor 135 (Gpr135)

This Recombinant Rat Probable G-protein coupled receptor 135 (Gpr135) spans the amino acid sequence from region 1-457.

Product Specifications

Product Name Alternative

Probable G-protein coupled receptor 135

UniProt

Q7TQN7

Expression Region

1-457

Origin

Rattus norvegicus (Rat)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEEQARPPSRPAASATLPGSAHPGGAASTATAAALSFSSVATVTLGNQSDAGRPEAAGSR GPAPLLWHGAAVAAQALVLLLIFLLSSLGNCAVMGVIVKHRQLRTVTNAFILSLSLSDLL TALLCLPAAFLDLFAPPGDSGPWRSFCAASRFFSSCFGIVSTFSVALISLDRYCAIVRPP RDKLGRRRALQLLAGAWLAALGFSLPWELLRAPREPPTPQSFHRCLYRTSPDPAQLGAAY SVGLVVACYLLPFLLMCFCRYHICKTVRLSDVRVRPMTTYARVLRFFSEVRTATTVLIMI VFVICCWGPYCFLVLLAATRQGQTTQAPSLLNVAAVWLTWANGAINPVIYAIRNPNISMF LGRNREEGYRTRNMDVFLPSQGLGFQARSRNRLRNGCANRLGACSRMPSSNPASGSGGEV VMWARKNPVVLFFREDPPDPVMAVYKQHKSETRDSSI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD8 (C8/1035), CF405S conjugate, 0.1mg/mL
BNC041035-100 1x 100 µL

CD8 (C8/1035), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF647 conjugate, 0.1mg/mL
BNC470806-500 1x 500 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF594 conjugate, 0.1mg/mL
BNC940003-100 1x 100 µL

CD45RO (UCHL-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (186-2G9), CF488A conjugate, 0.1mg/mL
BNC880178-100 1x 100 µL

CD50 (ICAM-3) (186-2G9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF640R conjugate, 0.1mg/mL
BNC400977-100 1x 100 µL

TGF-beta (1D11.16.8), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF647 conjugate, 0.1mg/mL
BNC471429-100 1x 100 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details