Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant UPF0359 membrane protein D1046.5 (D1046.5)

This Recombinant UPF0359 membrane protein D1046.5 (D1046.5) spans the amino acid sequence from region 1-458.

Product Specifications

Product Name Alternative

UPF0359 membrane protein D1046.5

UniProt

Q18936

Expression Region

1-458

Origin

Caenorhabditis elegans

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSVIFHENPGTSLGSVVPDTNTSFERESQLSVKTSPEWIDELFPNVSFIDSPTHQVIRGF CRDVFVYRLPGGFRVRYWDAVILVPNILFLLFLILKCGSVIRKLRTGNSPVLRAFTLLVY VSTLVNIIRCAYSMTLSMTDGLEQTVDQTLWIIIKFFYLTAEFCALTFGLLFGHLDNGKS ILIALLGTLLVSIPHTAVQVIIEMKIIDNSWLPLTYFDIQSDGGFLFWVFSSAVLALVYF FIMCLPLVCCQKYTKLPSKGSFLIYCMMMVVLNVLQSMGAALILFKSSDGLCFVGVSTYV YFVLYPPIIYFTFLRKKLKTPPNNTSGLFMYRKHKDEQGSGDLPDSYYPRFSGLTSPSYD DLFDYDRDARFTHYDISRNEYVQNPHYNTYSTPLIMTSVETAESTVTTRTGSDDYAHHRD SMLSEPSTGTTTRHLKGLGPQGSLVFEDDPSSLTSLRM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF488A conjugate, 0.1mg/mL
BNC880806-500 1x 500 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF647 conjugate, 0.1mg/mL
BNC470009-500 1x 500 µL

MART-1 / Melan-A (M2-7C10), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF640R conjugate, 0.1mg/mL
BNC400806-500 1x 500 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF640R conjugate, 0.1mg/mL
BNC400164-100 1x 100 µL

CD28 (204.12), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T3-3A1), CF594 conjugate, 0.1mg/mL
BNC940978-100 1x 100 µL

CD7 (T3-3A1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF568 conjugate, 0.1mg/mL
BNC680342-500 1x 500 µL

CD43 (84-3C1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details