Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Takifugu rubripes D (1) -like dopamine receptor

This Recombinant Takifugu rubripes D (1) -like dopamine receptor spans the amino acid sequence from region 1-459.

Product Specifications

Product Name Alternative

D (1) -like dopamine receptor

UniProt

P53452

Expression Region

1-459

Origin

Takifugu rubripes (Japanese pufferfish) (Fugu rubripes)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAQNFSTVGDGKQMLLERDSSKRVLTGCFLSLLIFTTLLGNTLVCVAVTKFRHLRSKVTN FFVISLAISDLLVAILVMPWKAATEIMGFWPFGEFCNIWVAFDIMCSTASILNLCVISVD RYWAISSPFRYERKMTPKVACLMISVAWTLSVLISFIPVQLNWHKAQTASYVELNGTYAG DLPPDNCDSSLNRTYAISSSLISFYIPVAIMIVTYTRIYRIAQKQIRRISALERAAESAQ NRHSSMGNSLSMESECSFKMSFKRETKVLKTLSVIMGVFVCCWLPFFILNCMVPFCEADD TTDFPCISSTTFDVFVWFGWANSSLNPIIYAFNADFRKAFSILLGCHRLCPGNSAIEIVS INNTGAPLSNPSCQYQPKSHIPKEGNHSSSYVIPHSILCQEEELQKKDGFGGEMEVGLVN NAMEKVSPAISGNFDSDAAVTLETINPITQNGQHKSMSC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC18 / Mucin 18 / CD146 (OJ79c), CF647 conjugate, 0.1mg/mL
BNC470676-500 1x 500 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNF alpha (J2D10), CF568 conjugate, 0.1mg/mL
BNC680994-500 1x 500 µL

TNF alpha (J2D10), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (LK1), CF740 conjugate, 0.1mg/mL
BNC740851-100 1x 100 µL

HSP60 (LK1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF405S conjugate, 0.1mg/mL
BNC040175-100 1x 100 µL

CD46 (122.2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG Immunoglobulin (IG266), CF405S conjugate, 0.1mg/mL
BNC040266-500 1x 500 µL

Human IgG Immunoglobulin (IG266), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF568 conjugate, 0.1mg/mL
BNC680342-500 1x 500 µL

CD43 (84-3C1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details