Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Drosophila melanogaster Probable G-protein coupled receptor Mth-like 6 (mthl6)

This Recombinant Drosophila melanogaster Probable G-protein coupled receptor Mth-like 6 (mthl6) spans the amino acid sequence from region 21-480.

Product Specifications

Product Name Alternative

Probable G-protein coupled receptor Mth-like 6, Protein methuselah-like 6

UniProt

Q9VS77

Expression Region

21-480

Origin

Drosophila melanogaster (Fruit fly)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

VIPGCDYFDTVDISHIPKLNDSYAYEELIIPAHLTGLYTFRQLADGSQEPVKSHLRACIC KLKPCIRFCCPRNKMMPNSRCSDGLTENLKRINPYLKITLEDGTIGKYYLLTDMIVLRYE FRYCEKVVSVQEDQYKLYENGSFMIKPDVNWTLSKQWYCLHPRLEDPNSIWILEHVYIPK SMPAVPQVGTISMVGCILTIAVYLYIKKLRNLLGKCFICYVFCKFVQYLIWAGGDLNLWN NICSLAGYTNYFFALASHFWLSVMSHQIWKNLRLINRDERSYHFLIYNIYGWGTPAIMTA ITYLVDWAWEDRPDKLNWIPGVGLYRCWINTYDWSAMIYLYGPMLILSLFNVVTFILTVN HIMKIKSSVKSSTQQQRKCIQNNDFLLYLRLSVMMGVTGISEVITYFVKRHKFWRQVLRV PNFFHLGSGIVVFVLFILKRSTFQMIMERISGPRRQQPAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD106 / VCAM1 (B-K9), CF405S conjugate, 0.1mg/mL
BNC040304-500 1x 500 µL

CD106 / VCAM1 (B-K9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF647 conjugate, 0.1mg/mL
BNC470391-500 1x 500 µL

CD81 / TAPA-1 (1.3.3.22), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (186-2G9), CF647 conjugate, 0.1mg/mL
BNC470178-500 1x 500 µL

CD50 (ICAM-3) (186-2G9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
S100B (S100B/1012), CF647 conjugate, 0.1mg/mL
BNC471012-100 1x 100 µL

S100B (S100B/1012), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TRAcP (Tartarate Resistant Acid Phosphatase) (ACP5/1070), CF640R conjugate, 0.1mg/mL
BNC401070-500 1x 500 µL

TRAcP (Tartarate Resistant Acid Phosphatase) (ACP5/1070), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1387), CF488A conjugate, 0.1mg/mL
BNC881387-500 1x 500 µL

Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1387), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details