Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Kluyveromyces lactis Dol-P-Man:Man (5) GlcNAc (2) -PP-Dol alpha-1,3-mannosyltransferase (ALG3)

This Recombinant Kluyveromyces lactis Dol-P-Man:Man (5) GlcNAc (2) -PP-Dol alpha-1,3-mannosyltransferase (ALG3) spans the amino acid sequence from region 1-462.

Product Specifications

Product Name Alternative

Dol-P-Man:Man (5) GlcNAc (2) -PP-Dol alpha-1,3-mannosyltransferase, EC= 2.4.1.258, Asparagine-linked glycosylation protein 6, Dol-P-Man-dependent alpha (1-3) -mannosyltransferase, Dolichyl-P-Man:Man (5) Gl

UniProt

Q6CMF1

Expression Region

1-462

Origin

Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVEEGANKTVGAPTVGDDQQPKEFVRPPFTPFQDILDAFNYLMWNPEANAIAMPVLILLE SIAMKFIQNKVSYTEIDYTAYMEQIWMIQNGERDYSQIKGGTGPLVYPAGHVFIYKIFEW VSDGLENISEAQDLFRYLYVITLMIQFMCFGLLNIPPGYAIFAILSKRLHSVYVLRLFND CFTTLFMSLAVLVMILCAKYKIRGFLVLIGSSFYSMAVSIKMNALLYLPGVLLTIYLLER CNTFKIVLNLAVMVIWQVIIAIPFWKEYPWEYLQSAFNFSRQFMYKWSVNWQMVDEEVFL DPLFHRSLLISHVIVLVVFLFYKLIPTNMNTPAGLLKIGKANLLHPFTDAVFSAMRVNAE QIAYILLVTNYIGVLFARSLHYQFLSWYHWTLPVLLNWANVPYPLCVLWYLTHEWCWNSY PPNATASTLLHACNTSLLLAVFLRGPANSKSGDNETTHEKAE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 17 (E3), CF405S conjugate, 0.1mg/mL
BNC040158-100 1x 100 µL

Cytokeratin 17 (E3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF594 conjugate, 0.1mg/mL
BNC940449-500 1x 500 µL

CD104 (UM-A9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF647 conjugate, 0.1mg/mL
BNC470645-100 1x 100 µL

FOXP3 (3G3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), CF405S conjugate, 0.1mg/mL
BNC040225-500 1x 500 µL

Major Vault Protein (MVP) (1032), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgM Immunoglobulin (Cocktail), CF647 conjugate, 0.1mg/mL
BNC470762-100 1x 100 µL

IgM Immunoglobulin (Cocktail), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TCL1 (T-Cell Marker) (TCL1/2747R), CF568 conjugate, 0.1mg/mL
BNC682747-100 1x 100 µL

TCL1 (T-Cell Marker) (TCL1/2747R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details