Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Alpha-2C adrenergic receptor (ADRA2C)

This Recombinant Human Alpha-2C adrenergic receptor (ADRA2C) spans the amino acid sequence from region 1-462.

Product Specifications

Product Name Alternative

Alpha-2C adrenergic receptor, Alpha-2 adrenergic receptor subtype C4, Alpha-2C adrenoreceptor, Alpha-2C adrenoceptor, Alpha-2CAR

UniProt

P18825

Expression Region

1-462

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASPALAAALAVAAAAGPNASGAGERGSGGVANASGASWGPPRGQYSAGAVAGLAAVVGF LIVFTVVGNVLVVIAVLTSRALRAPQNLFLVSLASADILVATLVMPFSLANELMAYWYFG QVWCGVYLALDVLFCTSSIVHLCAISLDRYWSVTQAVEYNLKRTPRRVKATIVAVWLISA VISFPPLVSLYRQPDGAAYPQCGLNDETWYILSSCIGSFFAPCLIMGLVYARIYRVAKLR TRTLSEKRAPVGPDGASPTTENGLGAAAGAGENGHCAPPPADVEPDESSAAAERRRRRGA LRRGGRRRAGAEGGAGGADGQGAGPGAAESGALTASRSPGPGGRLSRASSRSVEFFLSRR RRARSSVCRRKVAQAREKRFTFVLAVVMGVFVLCWFPFFFSYSLYGICREACQVPGPLFK FFFWIGYCNSSLNPVIYTVFNQDFRRSFKHILFRRRRRGFRQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRMT3 Blocking Peptide
33R-4896 0.1 mg

PRMT3 Blocking Peptide

Sign In for Pricing
View Details
Transcription Factor p65 / NFKB3 (RELA) Antibody
abx326117-01 50 µg

Transcription Factor p65 / NFKB3 (RELA) Antibody

Sign In for Pricing
View Details
Transcription Factor p65 / NFKB3 (RELA) Antibody
abx326117-02 100 µg

Transcription Factor p65 / NFKB3 (RELA) Antibody

Sign In for Pricing
View Details
BD BioCoat Collagen I Coated 12 Well Tissue Culture Plate
354500 5 / PCK

BD BioCoat Collagen I Coated 12 Well Tissue Culture Plate

Sign In for Pricing
View Details
MLN Antibody - middle region : Biotin (ARP44916_P050-Biotin)
ARP44916_P050-Biotin 100 µL

MLN Antibody - middle region : Biotin (ARP44916_P050-Biotin)

Sign In for Pricing
View Details
Nhej1 (NM_029342) Mouse Tagged ORF Clone
MR204061 10 µg

Nhej1 (NM_029342) Mouse Tagged ORF Clone

Sign In for Pricing
View Details