Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus laevis D (1C) dopamine receptor

This Recombinant Xenopus laevis D (1C) dopamine receptor spans the amino acid sequence from region 1-465.

Product Specifications

Product Name Alternative

D (1C) dopamine receptor

UniProt

P42291

Expression Region

1-465

Origin

Xenopus laevis (African clawed frog)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENFSIFNVTVNVWHADLDVGNSDLSLRALTGLLLSLLILSTLLGNTLVCLAVIKFRHLR SKVTNFFVISLAVSDLFVALLVMPWKAVTEVAGFWVFGDFCDTWVAFDIMCSTASILNLC IISLDRYWAIASPFRYERKMTQRVAFIMIGVAWTLSILISFIPVQLSWHKSHEADEELNG VNHTENCDSSLNRTYAISSSLISFYIPVVIMIGTYTRIYRIAQTQIRRISSLERAVEHAQ RCSSRLSNENSLKTSFRKETKVLKTLSIIMGVFVFCWLPFFVLNCMIPFCHMNLPGQNEP EPPCVSETTFNIFVWFGWANSSLNPVIYAFNADFRKAFTTILGCNRFCSSNNVEAVNFSN ELVSYHHDTTFQKDIPVTFNNSHLPNVVDQDQEVLEGTCFDKVSVLSTSHGTRSQKNLHL PAGVQFECEAEITLETITPFTSTGPLECLPQLVADEDRHYTTKLY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 17 (E3), CF405S conjugate, 0.1mg/mL
BNC040158-100 1x 100 µL

Cytokeratin 17 (E3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF555 conjugate, 0.1mg/mL
BNC550146-500 1x 500 µL

CD10 (CB-CALLA), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF647 conjugate, 0.1mg/mL
BNC470270-100 1x 100 µL

Fibronectin (HFN7.1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD59 (heavy chain of Protectin) (BRA-10G), CF568 conjugate, 0.1mg/mL
BNC680181-100 1x 100 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Kappa Light Chain / IGKC (B-Cell Marker) (KLC2289R), CF405S conjugate, 0.1mg/mL
BNC042289-500 1x 500 µL

Human Kappa Light Chain / IGKC (B-Cell Marker) (KLC2289R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (T-Cell Marker) (rSPN/1094), CF488A conjugate, 0.1mg/mL
BNC881858-100 1x 100 µL

CD43 (T-Cell Marker) (rSPN/1094), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details