Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Alpha-1A adrenergic receptor (Adra1a)

This Recombinant Mouse Alpha-1A adrenergic receptor (Adra1a) spans the amino acid sequence from region 1-466.

Product Specifications

Product Name Alternative

Alpha-1A adrenergic receptor, Alpha-1A adrenoreceptor, Alpha-1A adrenoceptor, Alpha-1C adrenergic receptor

UniProt

P97718

Expression Region

1-466

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVLLSENASEGSNCTHPPAQVNISKAILLGVILGGLIIFGVLGNILVILSVACHRHLHSV THYYIVNLAVADLLLTSTVLPFSAIFEILGYWAFGRVFCNIWAAVDVLCCTASIMGLCII SIDRYIGVSYPLRYPTIVTQRRGVRALLCVWALSLVISIGPLFGWRQQAPEDETICQINE EPGYVLFSALGSFYVPLTIILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKN VPAEGSGVSSAKNKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPN FKPPETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRIQCLRRRQSSKHALGYTL HPPSQAVEGQHRGMVRIPVGSGETFYKISKTDGVREWKFFSSMPQGSARITMPKDQSACT TARVRSKSFLQVCCCVGSSTPRPEENHQVPTIKIHTISLGENGEEV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LMO7DN Rabbit Polyclonal Antibody (HRP)
orb2583947 100 µg

LMO7DN Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Human Rnase3/Ecp (Ribonuclease A3/Eosinophil Cationic Protein) ELISA Kit
FY-EH2807 96 Well

Human Rnase3/Ecp (Ribonuclease A3/Eosinophil Cationic Protein) ELISA Kit

Sign In for Pricing
View Details
RAPGEF2 (NM_014247) Human Tagged ORF Clone
RC222055 10 µg

RAPGEF2 (NM_014247) Human Tagged ORF Clone

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Geranylgeranyl Diphosphate Synthase 1 (GGPS1)
MBS2094585-01 0.1 mL

Biotin-Linked Polyclonal Antibody to Geranylgeranyl Diphosphate Synthase 1 (GGPS1)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Geranylgeranyl Diphosphate Synthase 1 (GGPS1)
MBS2094585-02 0.2 mL

Biotin-Linked Polyclonal Antibody to Geranylgeranyl Diphosphate Synthase 1 (GGPS1)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Geranylgeranyl Diphosphate Synthase 1 (GGPS1)
MBS2094585-03 0.5 mL

Biotin-Linked Polyclonal Antibody to Geranylgeranyl Diphosphate Synthase 1 (GGPS1)

Sign In for Pricing
View Details