Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Alpha-1A adrenergic receptor (Adra1a)

This Recombinant Mouse Alpha-1A adrenergic receptor (Adra1a) spans the amino acid sequence from region 1-466.

Product Specifications

Product Name Alternative

Alpha-1A adrenergic receptor, Alpha-1A adrenoreceptor, Alpha-1A adrenoceptor, Alpha-1C adrenergic receptor

UniProt

P97718

Expression Region

1-466

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVLLSENASEGSNCTHPPAQVNISKAILLGVILGGLIIFGVLGNILVILSVACHRHLHSV THYYIVNLAVADLLLTSTVLPFSAIFEILGYWAFGRVFCNIWAAVDVLCCTASIMGLCII SIDRYIGVSYPLRYPTIVTQRRGVRALLCVWALSLVISIGPLFGWRQQAPEDETICQINE EPGYVLFSALGSFYVPLTIILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKN VPAEGSGVSSAKNKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPN FKPPETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRIQCLRRRQSSKHALGYTL HPPSQAVEGQHRGMVRIPVGSGETFYKISKTDGVREWKFFSSMPQGSARITMPKDQSACT TARVRSKSFLQVCCCVGSSTPRPEENHQVPTIKIHTISLGENGEEV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human TXNDC16 shRNA (UAS) - Lentiviral human TXNDC16 shRNA (UAS, RFP) (100)
GTR15081120 1 Vial

Lentiviral human TXNDC16 shRNA (UAS) - Lentiviral human TXNDC16 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS616647 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
Recombinant Shewanella halifaxensis Membrane-bound lytic murein transglycosylase F (mltF)
MBS1043516-01 0.02 mg (E-Coli)

Recombinant Shewanella halifaxensis Membrane-bound lytic murein transglycosylase F (mltF)

Sign In for Pricing
View Details
Recombinant Shewanella halifaxensis Membrane-bound lytic murein transglycosylase F (mltF)
MBS1043516-02 0.02 mg (Yeast)

Recombinant Shewanella halifaxensis Membrane-bound lytic murein transglycosylase F (mltF)

Sign In for Pricing
View Details
Recombinant Shewanella halifaxensis Membrane-bound lytic murein transglycosylase F (mltF)
MBS1043516-03 0.1 mg (E-Coli)

Recombinant Shewanella halifaxensis Membrane-bound lytic murein transglycosylase F (mltF)

Sign In for Pricing
View Details
Recombinant Shewanella halifaxensis Membrane-bound lytic murein transglycosylase F (mltF)
MBS1043516-04 0.1 mg (Yeast)

Recombinant Shewanella halifaxensis Membrane-bound lytic murein transglycosylase F (mltF)

Sign In for Pricing
View Details