Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Alpha-1A adrenergic receptor (ADRA1A)

This Recombinant Bovine Alpha-1A adrenergic receptor (ADRA1A) spans the amino acid sequence from region 1-466.

Product Specifications

Product Name Alternative

Alpha-1A adrenergic receptor, Alpha-1A adrenoreceptor, Alpha-1A adrenoceptor, Alpha-1C adrenergic receptor

UniProt

P18130

Expression Region

1-466

Origin

Bos taurus (Bovine)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVFLSGNASDSSNCTHPPPPVNISKAILLGVILGGLILFGVLGNILVILSVACHRHLHSV THYYIVNLAVADLLLTSTVLPFSAIFEILGYWAFGRVFCNVWAAVDVLCCTASIMGLCII SIDRYIGVSYPLRYPTIVTQKRGLMALLCVWALSLVISIGPLFGWRQPAPEDETICQINE EPGYVLFSALGSFYVPLTIILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKN AQVGGSGVTSAKNKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPD FRPSETVFKIAFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRIQCLRRKQSSKHTLGYTL HAPSHVLEGQHKDLVRIPVGSAETFYKISKTDGVCEWKIFSSLPRGSARMAVARDPSACT TARVRSKSFLQVCCCLGPSTPSHGENHQIPTIKIHTISLSENGEEV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (VU-1D9), CF568 conjugate, 0.1mg/mL
BNC680017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF568 conjugate, 0.1mg/mL
BNC680633-500 1x 500 µL

Von Willebrand Factor (3E2D10), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (LK1), CF594 conjugate, 0.1mg/mL
BNC940851-500 1x 500 µL

HSP60 (LK1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF740 conjugate, 0.1mg/mL
BNC740204-100 1x 100 µL

Complement C4d (C4D204), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF405S conjugate, 0.1mg/mL
BNC040304-100 1x 100 µL

CD106 / VCAM1 (B-K9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD1a / HTA1 (Mature Langerhans Cells Marker) (C1A/1506R), CF647 conjugate, 0.1mg/mL
BNC471506-100 1x 100 µL

CD1a / HTA1 (Mature Langerhans Cells Marker) (C1A/1506R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details