Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Beta-1 adrenergic receptor (Adrb1)

This Recombinant Rat Beta-1 adrenergic receptor (Adrb1) spans the amino acid sequence from region 1-466.

Product Specifications

Product Name Alternative

Beta-1 adrenergic receptor, Beta-1 adrenoreceptor, Beta-1 adrenoceptor

UniProt

P18090

Expression Region

1-466

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGAGALALGASEPCNLSSAAPLPDGAATAARLLVLASPPASLLPPASEGSAPLSQQWTAG MGLLLALIVLLIVVGNVLVIVAIAKTPRLQTLTNLFIMSLASADLVMGLLVVPFGATIVV WGRWEYGSFFCELWTSVDVLCVTASIETLCVIALDRYLAITLPFRYQSLLTRARARALVC TVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASSVVSFYVPLCIM AFVYLRVFREAQKQVKKIDSCERRFLTGPPRPPSPAPSPSPGPPRPADSLANGRSSKRRP SRLVALREQKALKTLGIIMGVFTLCWLPFFLANVVKAFHRDLVPDRLFVFFNWLGYANSA FNPIIYCRSPDFRKAFQRLLCCARRAACRRRAAHGDRPRASGCLARAGPPPSPGAPSDDD DDDAGATPPARLLEPWAGCNGGTTTVDSDSSLDEPGRQGFSSESKV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LC3 Polyclonal Antibody, PE-Cy5 Conjugated
bs-8878R-PE-Cy5 100 µL

LC3 Polyclonal Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details
MLH1, CT (DNA mismatch repair protein Mlh1, MutL protein homolog 1, COCA2, MLH1) (FITC)
MBS6321078-01 0.2 mL

MLH1, CT (DNA mismatch repair protein Mlh1, MutL protein homolog 1, COCA2, MLH1) (FITC)

Sign In for Pricing
View Details
MLH1, CT (DNA mismatch repair protein Mlh1, MutL protein homolog 1, COCA2, MLH1) (FITC)
MBS6321078-02 5x 0.2 mL

MLH1, CT (DNA mismatch repair protein Mlh1, MutL protein homolog 1, COCA2, MLH1) (FITC)

Sign In for Pricing
View Details
Mouse SLC4A10 shRNA Plasmid
abx979302-01 150 µg

Mouse SLC4A10 shRNA Plasmid

Sign In for Pricing
View Details
Mouse SLC4A10 shRNA Plasmid
abx979302-02 300 µg

Mouse SLC4A10 shRNA Plasmid

Sign In for Pricing
View Details
TBC1D23 ORF Vector (Human) (pORF)
46240011 1.0 µg DNA

TBC1D23 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details