Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Beta-1 adrenergic receptor (Adrb1)

This Recombinant Rat Beta-1 adrenergic receptor (Adrb1) spans the amino acid sequence from region 1-466.

Product Specifications

Product Name Alternative

Beta-1 adrenergic receptor, Beta-1 adrenoreceptor, Beta-1 adrenoceptor

UniProt

P18090

Expression Region

1-466

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGAGALALGASEPCNLSSAAPLPDGAATAARLLVLASPPASLLPPASEGSAPLSQQWTAG MGLLLALIVLLIVVGNVLVIVAIAKTPRLQTLTNLFIMSLASADLVMGLLVVPFGATIVV WGRWEYGSFFCELWTSVDVLCVTASIETLCVIALDRYLAITLPFRYQSLLTRARARALVC TVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASSVVSFYVPLCIM AFVYLRVFREAQKQVKKIDSCERRFLTGPPRPPSPAPSPSPGPPRPADSLANGRSSKRRP SRLVALREQKALKTLGIIMGVFTLCWLPFFLANVVKAFHRDLVPDRLFVFFNWLGYANSA FNPIIYCRSPDFRKAFQRLLCCARRAACRRRAAHGDRPRASGCLARAGPPPSPGAPSDDD DDDAGATPPARLLEPWAGCNGGTTTVDSDSSLDEPGRQGFSSESKV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Influenza A virus RNA-directed RNA polymerase catalytic subunit (PB1), partial
MBS1205498 Inquire

Recombinant Influenza A virus RNA-directed RNA polymerase catalytic subunit (PB1), partial

Sign In for Pricing
View Details
Rat Glucose-6-Phosphatase, Catalytic (G6PC) ELISA Kit
RDR-G6PC-Ra-96Tests 96 Tests

Rat Glucose-6-Phosphatase, Catalytic (G6PC) ELISA Kit

Sign In for Pricing
View Details
CD45RB (B-Cell Marker) Antibody - With BSA and Azide
orb1462894-01 20 µg

CD45RB (B-Cell Marker) Antibody - With BSA and Azide

Sign In for Pricing
View Details
CD45RB (B-Cell Marker) Antibody - With BSA and Azide
orb1462894-02 100 µg

CD45RB (B-Cell Marker) Antibody - With BSA and Azide

Sign In for Pricing
View Details
Recombinant ACAT2 Rabbit mAb
E38MA4238 100 µL

Recombinant ACAT2 Rabbit mAb

Sign In for Pricing
View Details
HSV1 (Herpes Simplex Virus Type I) (N/A), 0.2mg/mL
BNUB1800-500 1x 500 µL

HSV1 (Herpes Simplex Virus Type I) (N/A), 0.2mg/mL

Sign In for Pricing
View Details