Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Neuropeptide Y receptor type 5 (Npy5r)

This Recombinant Mouse Neuropeptide Y receptor type 5 (Npy5r) spans the amino acid sequence from region 1-466.

Product Specifications

Product Name Alternative

Neuropeptide Y receptor type 5, NPY5-R, NPY-Y5 receptor, NPYY5-R, Y5 receptor

UniProt

O70342

Expression Region

1-466

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEVKLEEHFNKTFVTENNTAASQNTASPAWEDYRGTENNTSAARNTAFPVWEDYRGSVDD LQYFLIGLYTFVSLLGFMGNLLILMAVMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTL TSVLLDQWMFGKAMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFL IATVWTLGFAICSPLPVFHSLVELKETFGSALLSSKYLCVESWPSDSYRIAFTISLLLVQ YILPLVCLTVSHTSVCRSISCGLSHKENRLEENEMINLTLHPSKKSRDQAKPPSTQKWSY SFIRKHRRRYSKKTACVLPAPAGPSQEKHLTVPENPGSVRSQLSPSSKVIPGVPICFEVK PEESSDAQEMRVKRSLTRIKKRSRSVFYRLTILILVFAVSWMPLHVFHVVTDFNDNLISN RHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLRALIHCLHMS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Lung
CS500722 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
HER-2 / c-erbB-2 / neu / CD340 (ERBB2/3079), CF740 conjugate, 0.1mg/mL
BNC743079-500 1x 500 µL

HER-2 / c-erbB-2 / neu / CD340 (ERBB2/3079), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Junctional Adhesion MolecuLe C (JAM3) (NM_032801) Human Over-expression Lysate
LY403197 100 µg

Junctional Adhesion MolecuLe C (JAM3) (NM_032801) Human Over-expression Lysate

Sign In for Pricing
View Details
Neutravidin Coated - 96 well Solid plates - Clear PS
MC21F-NA/W 10x 96 Well Plates

Neutravidin Coated - 96 well Solid plates - Clear PS

Sign In for Pricing
View Details
Double Stranded DNA (dsDNA) (AE-2), CF594 conjugate, 0.1mg/mL
BNC940946-500 1x 500 µL

Double Stranded DNA (dsDNA) (AE-2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS630431 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details