Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Neuropeptide Y receptor type 5 (Npy5r)

This Recombinant Mouse Neuropeptide Y receptor type 5 (Npy5r) spans the amino acid sequence from region 1-466.

Product Specifications

Product Name Alternative

Neuropeptide Y receptor type 5, NPY5-R, NPY-Y5 receptor, NPYY5-R, Y5 receptor

UniProt

O70342

Expression Region

1-466

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEVKLEEHFNKTFVTENNTAASQNTASPAWEDYRGTENNTSAARNTAFPVWEDYRGSVDD LQYFLIGLYTFVSLLGFMGNLLILMAVMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTL TSVLLDQWMFGKAMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFL IATVWTLGFAICSPLPVFHSLVELKETFGSALLSSKYLCVESWPSDSYRIAFTISLLLVQ YILPLVCLTVSHTSVCRSISCGLSHKENRLEENEMINLTLHPSKKSRDQAKPPSTQKWSY SFIRKHRRRYSKKTACVLPAPAGPSQEKHLTVPENPGSVRSQLSPSSKVIPGVPICFEVK PEESSDAQEMRVKRSLTRIKKRSRSVFYRLTILILVFAVSWMPLHVFHVVTDFNDNLISN RHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLRALIHCLHMS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Stomach
CS622104 5x 5 µm

Frozen Tissue Sections, Stomach

Sign In for Pricing
View Details
SARG (C1orf116) Human Gene Knockout Kit (CRISPR)
KN400882 1 Kit

SARG (C1orf116) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MCPA-L-carnitine (Mixture of Diastereomers)
TRC-M199700-5MG 5 mg

MCPA-L-carnitine (Mixture of Diastereomers)

Sign In for Pricing
View Details
Glycine max Gel -SBA- Immobilized Lectin
AK-1301-1 1 mL/Kit

Glycine max Gel -SBA- Immobilized Lectin

Sign In for Pricing
View Details
Recombinant Human Lyn Kinase Protein (GST Tag)
PKSH030378 50 µg

Recombinant Human Lyn Kinase Protein (GST Tag)

Sign In for Pricing
View Details
PPP1A (PPP1CA) Mouse Monoclonal Antibody [Clone ID: OTI6E5]
CF808819 100 µg

PPP1A (PPP1CA) Mouse Monoclonal Antibody [Clone ID: OTI6E5]

Sign In for Pricing
View Details