Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sheep Beta-1 adrenergic receptor (ADRB1)

This Recombinant Sheep Beta-1 adrenergic receptor (ADRB1) spans the amino acid sequence from region 1-467.

Product Specifications

Product Name Alternative

Beta-1 adrenergic receptor, Beta-1 adrenoreceptor, BETA1AR, Beta-1 adrenoceptor

UniProt

Q28927

Expression Region

1-467

Origin

Ovis aries (Sheep)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGAGALALGASEPCNLSFAAPVPDGAATAARLLVPXSPLRLAADLGQRGTPLLSQQWTVG MGLLMAFIVLLIVAGNVLVIVAIAKTPRLQTLTNLFIMSLASADLVMGLLVVPFGATIVV WGRWEYGSFFCELWTSVDVLCVTASIETLCVIALDRYLAITSPFRYQSLLTRARARALVC TVWAISALVSFLPIFMQWWGDKDAKASRCYNDPECCDFIINEGYAITSSVVSFYVPLCIM AFVYLRVFREAQKQVKKIDSCERRFLSGPARLPSPALSPGAPLPAAAVANGRANKRRPSR LVALREQKALKTLGIIMGVFTLCWLPFFLANVVKAFHRDLVPDRLFVFFNWLGYANSAFN PIIYCRSPDFRKAFQRLLCCARRAACGSHGAAGDPPRAAGCLAVARPSPSPGAASDDDDD DDEDDVGAAPPVRLLQPWAGYNGGAAANSDSSPDEPSRPGCGSESKV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CA5A/CA-VA Protein (His Tag)
PKSH031568 50 µg

Recombinant Human CA5A/CA-VA Protein (His Tag)

Sign In for Pricing
View Details
Parathyroid Hormone (PTH) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1C6]
TA800944AM 100 µL

Parathyroid Hormone (PTH) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1C6]

Sign In for Pricing
View Details
Tissue FFPE Sections, Fallopian tube
CS803235 5x 5 µm

Tissue FFPE Sections, Fallopian tube

Sign In for Pricing
View Details
ADHFE1 Human qPCR Primer Pair (NM_144650)
HP225854 200 Reactions

ADHFE1 Human qPCR Primer Pair (NM_144650)

Sign In for Pricing
View Details
Glycinamide ribonucleoside hydrochloride
TRC-G573880-50MG 50 mg

Glycinamide ribonucleoside hydrochloride

Sign In for Pricing
View Details
Human ICOS activation kit by CRISPRa
GA109283 1 Kit

Human ICOS activation kit by CRISPRa

Sign In for Pricing
View Details