Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human D (4) dopamine receptor (DRD4)

This Recombinant Human D (4) dopamine receptor (DRD4) spans the amino acid sequence from region 1-467.

Product Specifications

Product Name Alternative

D (4) dopamine receptor, D (2C) dopamine receptor, Dopamine D4 receptor

UniProt

P21917

Expression Region

1-467

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGNRSTADADGLLAGRGPAAGASAGASAGLAGQGAAALVGGVLLIGAVLAGNSLVCVSVA TERALQTPTNSFIVSLAAADLLLALLVLPLFVYSEVQGGAWLLSPRLCDALMAMDVMLCT ASIFNLCAISVDRFVAVAVPLRYNRQGGSRRQLLLIGATWLLSAAVAAPVLCGLNDVRGR DPAVCRLEDRDYVVYSSVCSFFLPCPLMLLLYWATFRGLQRWEVARRAKLHGRAPRRPSG PGPPSPTPPAPRLPQDPCGPDCAPPAPGLPRGPCGPDCAPAAPGLPPDPCGPDCAPPAPG LPQDPCGPDCAPPAPGLPRGPCGPDCAPPAPGLPQDPCGPDCAPPAPGLPPDPCGSNCAP PDAVRAAALPPQTPPQTRRRRRAKITGRERKAMRVLPVVVGAFLLCWTPFFVVHITQALC PACSVPPRLVSAVTWLGYVNSALNPVIYTVFNAEFRNVFRKALRACC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCNA7 Human shRNA Plasmid Kit (Locus ID 3743)
TL307351 1 Kit

KCNA7 Human shRNA Plasmid Kit (Locus ID 3743)

Sign In for Pricing
View Details
PCCB CRISPR Activation Plasmid (m2)
sc-426258-ACT-2 20 µg

PCCB CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
Mouse Defensin Alpha 1, Neutrophil (DEFa1) ELISA Kit
RDR-DEFa1-Mu-96Tests 96 Tests

Mouse Defensin Alpha 1, Neutrophil (DEFa1) ELISA Kit

Sign In for Pricing
View Details
IL1B/IL1F2 Mouse Monoclonal Antibody (APC)
orb2973280-01 50 Tests

IL1B/IL1F2 Mouse Monoclonal Antibody (APC)

Sign In for Pricing
View Details
IL1B/IL1F2 Mouse Monoclonal Antibody (APC)
orb2973280-02 100 Tests

IL1B/IL1F2 Mouse Monoclonal Antibody (APC)

Sign In for Pricing
View Details
Eppendorf CryoStorage Vial 1.5mL
E0030079426 480 / PCK

Eppendorf CryoStorage Vial 1.5mL

Sign In for Pricing
View Details