Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Phodopus sungorus Melanopsin (OPN4)

This Recombinant Phodopus sungorus Melanopsin (OPN4) spans the amino acid sequence from region 1-469.

Product Specifications

Product Name Alternative

Melanopsin, Opsin-4

UniProt

Q5XXP2

Expression Region

1-469

Origin

Phodopus sungorus (Striped hairy-footed hamster) (Djungarian hamster)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDSPPGPTAPPGLTQGPSFMASTTLHSHWNSTQKVSTRAQLLAVSPTASGPEAAAWVPFP TVDVPDHAHYILGTVILLVGLTGMLGNLTVIYTFCRSRSLRTPANMLIINLAVSDFLMSF TQAPVFFASSLYKKWLFGETGCEFYAFCGAVLGITSMITLTAIALDRYLVITRPLATIGM GSKRRTALVLLGIWLYALAWSLPPFFGWSAYVPEGLLTSCSWDYVTFTPQVRAYTMLLFC FVFFLPLLVIIFCYISIFRAIRETGRACEGWSESPQRRRQWHRLQSEWKMAKVALIVILL FVLSWAPYSTVALVAFAGYSHILTPYMSSVPAVIAKASAIHNPIVYAITHPKYRAAIAQH LPCLGVLLGVSSQRNRPSLSYRSTHRSTLSSQSSDLSWISAPKRQESLGSESEVGWTDTE ATAVWGAAQPASGQSSCGQNLEDGMVKAPSSPQAKGQLPSLDLGMQDAP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gemin 8 (GEMIN8) Mouse Monoclonal Antibody [Clone ID: OTI4B12]
CF805834 100 µg

Gemin 8 (GEMIN8) Mouse Monoclonal Antibody [Clone ID: OTI4B12]

Sign In for Pricing
View Details
HSV1 (Herpes Simplex Virus Type I) (N/A), CF740 conjugate, 0.1mg/mL
BNC741800-100 1x 100 µL

HSV1 (Herpes Simplex Virus Type I) (N/A), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Interferon gamma Receptor 1 Antibody
KC-8862-01 50 μL

Interferon gamma Receptor 1 Antibody

Sign In for Pricing
View Details
Interferon gamma Receptor 1 Antibody
KC-8862-02 100 µL

Interferon gamma Receptor 1 Antibody

Sign In for Pricing
View Details
Interferon gamma Receptor 1 Antibody
KC-8862-03 1 mL

Interferon gamma Receptor 1 Antibody

Sign In for Pricing
View Details
Uncoated Human SOST (Sclerostin) ELISA Kit
E-UNEL-H0364-01 5x 96 Tests

Uncoated Human SOST (Sclerostin) ELISA Kit

Sign In for Pricing
View Details