Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Pheromone a factor receptor (STE3)

This Recombinant Saccharomyces cerevisiae Pheromone a factor receptor (STE3) spans the amino acid sequence from region 1-470.

Product Specifications

Product Name Alternative

Pheromone a factor receptor

UniProt

P06783

Expression Region

1-470

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSYKSAIIGLCLLAVILLAPPLAWHSHTKNIPAIILITWLLTMNLTCIVDAAIWSDDDFL TRWDGKGWCDIVIKLQVGANIGISCAVTNIIYNLHTILKADSVLPDLSSWTKIVKDLVIS LFTPVMVMGFSYLLQVFRYGIARYNGCQNLLSPTWITTVLYTMWMLIWSFVGAVYATLVL FVFYKKRKDVRDILHCTNSGLNLTRFARLLIFCFIIILVMFPFSVYTFVQDLQQVEGHYT FKNTHSSTIWNTIIKFDPGRPIYNIWLYVLMSYLVFLIFGLGSDALHMYSKFLRSIKLGF VLDMWKRFIDKNKEKRVGILLNKLSSRKESRNPFSTDSENYISTCTENYSPCVGTPISQA HFYVDYRIPDDPRKSQNKSKKYLFADKETDDILDEIDLKESRHIPYVTQGQSFDDEISLG GFSKVTLDYSEKLHNSASSNFEGESLCYSPASKEENSSSNEHSSENTAGP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Regulator of G-Protein Signaling 16 (RGS16) ELISA Kit
MBS9929829-01 48 Well

Porcine Regulator of G-Protein Signaling 16 (RGS16) ELISA Kit

Sign In for Pricing
View Details
Porcine Regulator of G-Protein Signaling 16 (RGS16) ELISA Kit
MBS9929829-02 96 Well

Porcine Regulator of G-Protein Signaling 16 (RGS16) ELISA Kit

Sign In for Pricing
View Details
Porcine Regulator of G-Protein Signaling 16 (RGS16) ELISA Kit
MBS9929829-03 5x 96 Well

Porcine Regulator of G-Protein Signaling 16 (RGS16) ELISA Kit

Sign In for Pricing
View Details
Porcine Regulator of G-Protein Signaling 16 (RGS16) ELISA Kit
MBS9929829-04 10x 96 Well

Porcine Regulator of G-Protein Signaling 16 (RGS16) ELISA Kit

Sign In for Pricing
View Details
PPP1CB, CT (PPP1CB, Serine/threonine-protein phosphatase PP1-beta catalytic subunit) (MaxLight 550) discontinued
040333-ML550 100 µL

PPP1CB, CT (PPP1CB, Serine/threonine-protein phosphatase PP1-beta catalytic subunit) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Recombinant Escherichia coli O6:K15:H31 Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC)
MBS7008034-01 0.02 mg

Recombinant Escherichia coli O6:K15:H31 Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC)

Sign In for Pricing
View Details