Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog 5-hydroxytryptamine receptor 2A (HTR2A)

This Recombinant Dog 5-hydroxytryptamine receptor 2A (HTR2A) spans the amino acid sequence from region 1-470.

Product Specifications

Product Name Alternative

5-hydroxytryptamine receptor 2A, 5-HT-2, 5-HT-2A, 5-hydroxytryptamine receptor, Serotonin receptor 2A

UniProt

O46635

Expression Region

1-470

Origin

Canis familiaris (Dog) (Canis lupus familiaris)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDVLFEDNAPLSPTTSSLMPSNGDPRLYGNDLNAGDANTSDAFNWTVDAENRTNLSCEGC LSPPCFSLLHLQEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIAD MLLGFLVMPVSMLTILYGYRWPLPSKLCAVWIYLDVLFSTASIMHLCAISLDRYVAIQNP IHHSRFNSRTKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGSCLLADDNFVLIGSF VSFFIPLTIMVITYFLTIKSLQKEATLCVSDPGTRAKLASFSFLPQSSLSSEKLFQRSIH REPGSYGRRTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCNEDIIGAL LNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCQYKENKKPLQLILVNTIPALAYKS SQLQMGQKKNSKKDAKSTDNDYSMVALGKQHSEDAPTDNINTVNEKVSCV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

T box 2 (TBX2) Rabbit Polyclonal Antibody
AP06721PU-N 100 µg

T box 2 (TBX2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human DCAF15 activation kit by CRISPRa
GA114012 1 Kit

Human DCAF15 activation kit by CRISPRa

Sign In for Pricing
View Details
Colloidal Gold Conjugated Monoclonal Antibody to Human IgG1 HP6091,  15nm
GM-201-15 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Human IgG1 HP6091, 15nm

Sign In for Pricing
View Details
Prostate Specific Antigen (KLK3) Human Gene Knockout Kit (CRISPR)
KN402740 1 Kit

Prostate Specific Antigen (KLK3) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
n-Heptyl 4-Hydroxybenzoate
TRC-H283180-5G 5 g

n-Heptyl 4-Hydroxybenzoate

Sign In for Pricing
View Details
IL36 alpha (IL36A) (NM_014440) Human Recombinant Protein
TP319328M 100 µg

IL36 alpha (IL36A) (NM_014440) Human Recombinant Protein

Sign In for Pricing
View Details