Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo pygmaeus 5-hydroxytryptamine receptor 2A (HTR2A)

This Recombinant Pongo pygmaeus 5-hydroxytryptamine receptor 2A (HTR2A) spans the amino acid sequence from region 1-471.

Product Specifications

Product Name Alternative

5-hydroxytryptamine receptor 2A, 5-HT-2, 5-HT-2A, Serotonin receptor 2A

UniProt

Q5R4Q6

Expression Region

1-471

Origin

Pongo pygmaeus (Bornean orangutan)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDILCEENTSLSSTTNSLMQLNDDTRLYSNDFNSGEANTSDAFNWTVDSENRTNLSCEGC LSPSCLSLLHLQEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIAD MLLGFLVMPVSMLTILYGYRWPLPSKLCAVWIYLDVLFSTASIMHLCAISLDRYVAIQNP IHHSRFNSRTKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGSCLLADDNFVLIGSF VSFFIPLTIMVITYFLTIKSLQKEATLCVSDLGTRAKLASFSFLPQSSLSSEKLFQRSIH REPGSYTGRRTMQSISNEQKACKVLGIVFSLFVVMWCPFFITNIMAVICKESCNEDVIGA LLNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCQYKENKKPLQLILVNTIPALAYK SSQLQMGQKKNSKQDAKTTDNDCSMVALGKQHSEDASKDNSDGVNEKVSCV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fluorescein Conjugated IgG fraction of anti-Mouse IgM [H&L] [Rabbit]
orb1674982 5 mg

Fluorescein Conjugated IgG fraction of anti-Mouse IgM [H&L] [Rabbit]

Sign In for Pricing
View Details
Lung cancer and lung tissue array with smoking history (2015 WHO classification), including pathology grade, TNM and clinical stage (small cell carcinoma reference AJCC 8th edition), 40 cases/80 cores
RLC-821 40 Cases / 80 Cores

Lung cancer and lung tissue array with smoking history (2015 WHO classification), including pathology grade, TNM and clinical stage (small cell carcinoma reference AJCC 8th edition), 40 cases/80 cores

Sign In for Pricing
View Details
Human B7-2/CD86 MAb (Clone 37324)
MAB1411-SP 25 µg

Human B7-2/CD86 MAb (Clone 37324)

Sign In for Pricing
View Details
PTPRG Protein Vector (Human) (pPB-C-His)
PV114278 500 ng

PTPRG Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Recombinant Human 3-hydroxyacyl-CoA dehydrogenase type-2/ HSD17B10
32-10176-500 500 µg

Recombinant Human 3-hydroxyacyl-CoA dehydrogenase type-2/ HSD17B10

Sign In for Pricing
View Details
ALG11 siRNA (h)
sc-105053 10 µM

ALG11 siRNA (h)

Sign In for Pricing
View Details