Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Drosophila melanogaster Probable G-protein coupled receptor Mth-like 8 (mthl8)

This Recombinant Drosophila melanogaster Probable G-protein coupled receptor Mth-like 8 (mthl8) spans the amino acid sequence from region 22-492.

Product Specifications

Product Name Alternative

Probable G-protein coupled receptor Mth-like 8, Protein methuselah-like 8

UniProt

Q9W0V7

Expression Region

22-492

Origin

Drosophila melanogaster (Fruit fly)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

FHEETHYPCAFIDTANITGSYGLDGPFVHNWTVIPRHFVAVYDFVIENGIRIPASRHLRA CVCKTKPCVRICCLRGEIYDLEKRQCLVPVAGVSSLPSHSHMEVELGNGSLRLVKLQPRF SIHVETPCEHMKAVTKGSEYVHWTLHENGTISHRGHIFSKHYCFTPLLHGNSTWEWQPLA CAPEKLYFVLGVREWTYAICLLIAILSMFIVLMVYLMCSEMRNSFYGVAIKAYAICMILG YALLAYLTLHNPANLSNAACRILPSLALMNLVLSFYILSFIAFKLYLSFYGVVFTKLMFW LIFTPIVLVAVGWSFFVGFSYYGSRLIFGGDTCWFDPRNWSVMIYFYAPVFVACAISGFF YVLSQIYIRDQPDIETEKSFESIEKNRFKSFWKYFGYTAVVWVVCICSFAFNYYWENRSH LNYAVSFCMAFHGFAALYALIGKNQQIQNFLRRIDNGEDTCENSVPLSSFG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD50 (ICAM-3) (186-2G9), CF740 conjugate, 0.1mg/mL
BNC740178-100 1x 100 µL

CD50 (ICAM-3) (186-2G9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF594 conjugate, 0.1mg/mL
BNC940633-100 1x 100 µL

Von Willebrand Factor (3E2D10), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF640R conjugate, 0.1mg/mL
BNC400146-100 1x 100 µL

CD10 (CB-CALLA), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (SX53G8), CF740 conjugate, 0.1mg/mL
BNC740669-100 1x 100 µL

P27 / KIP1 (SX53G8), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF640R conjugate, 0.1mg/mL
BNC400009-500 1x 500 µL

MART-1 / Melan-A (M2-7C10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11a (Cris-3), CF594 conjugate, 0.1mg/mL
BNC940151-500 1x 500 µL

CD11a (Cris-3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details