Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse 5-hydroxytryptamine receptor 2A (Htr2a)

This Recombinant Mouse 5-hydroxytryptamine receptor 2A (Htr2a) spans the amino acid sequence from region 1-471.

Product Specifications

Product Name Alternative

5-hydroxytryptamine receptor 2A, 5-HT-2, 5-HT-2A, Serotonin receptor 2A

UniProt

P35363

Expression Region

1-471

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEILCEDNISLSSIPNSLMQLGDDSRLYPNDFNSRDANTSEASNWTIDAENRTNLSCEGY LPPTCLSILHLQEKNWSALLTTVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIAD MLLGFLVMPVSMLTILYGYRWPLPSKLCAVWIYLDVLFSTASIMHLCAISLDRYVAIQNP IHHSRFNSRTKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGSCLLADDNFVLIGSF VAFFIPLTIMVITYFLTIKSLQKEATLCVSDLSTRAKLSSFSFLPQSSLSSEKLFQRSIH REPGSYAGRRTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCNENVIGA LLNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCQYKENRKPLQLILVNTIPTLAYK SSQLQVGQKKNSQEDAEPTANDCSMVTLGNQHSEEMCTDNIETVNEKVSCV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KIAA0182 Rabbit Polyclonal Antibody (FITC)
orb2105547 100 µL

KIAA0182 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
SNX6 Rabbit Polyclonal Antibody (BF350)
orb2534627 100 µL

SNX6 Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details
CHRNA9 (Neuronal Acetylcholine Receptor Subunit alpha-9, Nicotinic Acetylcholine Receptor Subunit alpha-9, NACHR alpha-9, CHRNA9, NACHRA9)
406247-01 50 µL

CHRNA9 (Neuronal Acetylcholine Receptor Subunit alpha-9, Nicotinic Acetylcholine Receptor Subunit alpha-9, NACHR alpha-9, CHRNA9, NACHRA9)

Sign In for Pricing
View Details
CHRNA9 (Neuronal Acetylcholine Receptor Subunit alpha-9, Nicotinic Acetylcholine Receptor Subunit alpha-9, NACHR alpha-9, CHRNA9, NACHRA9)
406247-02 100 µL

CHRNA9 (Neuronal Acetylcholine Receptor Subunit alpha-9, Nicotinic Acetylcholine Receptor Subunit alpha-9, NACHR alpha-9, CHRNA9, NACHRA9)

Sign In for Pricing
View Details
RPL36AP6 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV780555 1.0 µg DNA

RPL36AP6 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Phospho-PTEN-S380 polyclonal antibody
BS79459-01 50 µL

Phospho-PTEN-S380 polyclonal antibody

Sign In for Pricing
View Details