Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse 5-hydroxytryptamine receptor 2A (Htr2a)

This Recombinant Mouse 5-hydroxytryptamine receptor 2A (Htr2a) spans the amino acid sequence from region 1-471.

Product Specifications

Product Name Alternative

5-hydroxytryptamine receptor 2A, 5-HT-2, 5-HT-2A, Serotonin receptor 2A

UniProt

P35363

Expression Region

1-471

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEILCEDNISLSSIPNSLMQLGDDSRLYPNDFNSRDANTSEASNWTIDAENRTNLSCEGY LPPTCLSILHLQEKNWSALLTTVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIAD MLLGFLVMPVSMLTILYGYRWPLPSKLCAVWIYLDVLFSTASIMHLCAISLDRYVAIQNP IHHSRFNSRTKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGSCLLADDNFVLIGSF VAFFIPLTIMVITYFLTIKSLQKEATLCVSDLSTRAKLSSFSFLPQSSLSSEKLFQRSIH REPGSYAGRRTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCNENVIGA LLNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCQYKENRKPLQLILVNTIPTLAYK SSQLQVGQKKNSQEDAEPTANDCSMVTLGNQHSEEMCTDNIETVNEKVSCV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ethyl dimethylbenzeneacetate 99+% (GC)
237710-01 250 mg

Ethyl dimethylbenzeneacetate 99+% (GC)

Sign In for Pricing
View Details
Ethyl dimethylbenzeneacetate 99+% (GC)
237710-02 1 g

Ethyl dimethylbenzeneacetate 99+% (GC)

Sign In for Pricing
View Details
Ethyl dimethylbenzeneacetate 99+% (GC)
237710-03 5 g

Ethyl dimethylbenzeneacetate 99+% (GC)

Sign In for Pricing
View Details
Human Zinc finger CCHC domain-containing protein 23, ZCCHC23 ELISA Kit
MBS9335449-01 48 Well

Human Zinc finger CCHC domain-containing protein 23, ZCCHC23 ELISA Kit

Sign In for Pricing
View Details
Human Zinc finger CCHC domain-containing protein 23, ZCCHC23 ELISA Kit
MBS9335449-02 96 Well

Human Zinc finger CCHC domain-containing protein 23, ZCCHC23 ELISA Kit

Sign In for Pricing
View Details
Human Zinc finger CCHC domain-containing protein 23, ZCCHC23 ELISA Kit
MBS9335449-03 5x 96 Well

Human Zinc finger CCHC domain-containing protein 23, ZCCHC23 ELISA Kit

Sign In for Pricing
View Details