Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca mulatta (Rhesus macaque) 5-hydroxytryptamine receptor 2A (HTR2A)

This Recombinant Macaca mulatta (Rhesus macaque) 5-hydroxytryptamine receptor 2A (HTR2A) spans the amino acid sequence from region 1-471.

Product Specifications

Product Name Alternative

5-hydroxytryptamine receptor 2A, 5-HT-2, 5-HT-2A, Serotonin receptor 2A

UniProt

P50128

Expression Region

1-471

Origin

Macaca mulatta (Rhesus macaque)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDILCEENTSLSSTTNSLMQLNEDTRLYSNDFNSGEANTSDAFNWTVESENRTNLSCEGC LSPSCLSLLHLQEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIAD MLLGFLVMPVSMLTILYGYRWPLPSKLCAVWIYLDVLFSTASIMHLCAISLDRYVAIQNP IHHSRFNSRTKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGSCLLADDNFVLIGSF VSFFIPLTIMVITYFLTIKSLQKEATLCVSDLGTRAKLASFSFLPQSSLSSEKLFQRSIH RDPGSYTGRRTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCNEDVIGA LLNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCQYKENKKPLQLILVNTIPALAYK SSQLQMGQKKNSKQDAKTTDNDCSMVALGKQHSEDASKDNSDGVNEKVSCV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDC25B Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6H9]
TA812352BM 100 µL

CDC25B Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6H9]

Sign In for Pricing
View Details
Human PDGF-B, Tag Free
HA210859-01 20 µg

Human PDGF-B, Tag Free

Sign In for Pricing
View Details
Human PDGF-B, Tag Free
HA210859-02 50 µg

Human PDGF-B, Tag Free

Sign In for Pricing
View Details
Human PDGF-B, Tag Free
HA210859-03 100 µg

Human PDGF-B, Tag Free

Sign In for Pricing
View Details
Human CLPSL1 activation kit by CRISPRa
GA117464 1 Kit

Human CLPSL1 activation kit by CRISPRa

Sign In for Pricing
View Details
Biotin Conjugated Succinyl Triticum vulgare Lectin (Wheat Germ)-Succinyl WGA-
BA-2102-5 1 mg

Biotin Conjugated Succinyl Triticum vulgare Lectin (Wheat Germ)-Succinyl WGA-

Sign In for Pricing
View Details