Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 8B (TMEM8B)

This Recombinant Human Transmembrane protein 8B (TMEM8B) spans the amino acid sequence from region 1-472.

Product Specifications

Product Name Alternative

Transmembrane protein 8B, Nasopharyngeal carcinoma-associated gene 6 protein, Protein NAG-5, Protein NGX6

UniProt

A6NDV4

Expression Region

1-472

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNMPQSLGNQPLPPEPPSLGTPAEGPGTTSPPEHCWPVRPTLRNELDTFSVHFYIFFGPS VALPPERPAVFAMRLLPVLDSGGVLSLELQLNASSVRQENVTVFGCLTHEVPLSLGDAAV TCSKESLAGFLLSVSATTRVARLRIPFPQTGTWFLALRSLCGVGPRFVRCRNATAEVRMR TFLSPCVDDCGPYGQCKLLRTHNYLYAACECKAGWRGWGCTDSADALTYGFQLLSTLLLC LSNLMFLPPVVLAIRSRYVLEAAVYTFTMFFSTFYHACDQPGIVVFCIMDYDVLQFCDFL GSLMSVWVTVIAMARLQPVVKQVLYLLGAMLLSMALQLDRHGLWNLLGPSLFALGILATA WTVRSVRRRHCYPPTWRRWLFYLCPGSLIAGSAVLLYAFVETRDNYFYIHSIWHMLIAGS VGFLLPPRAKTDHGVPSGARARGCGYQLCINEQEELGLVGPGGATVSSICAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KIRA6 5mg
A12516-5 5 mg

KIRA6 5mg

Sign In for Pricing
View Details
BACH1 (Transcription Regulator Protein BACH1, BTB and CNC Homolog 1, HA2303) (MaxLight 750)
MBS6231732-01 0.1 mL

BACH1 (Transcription Regulator Protein BACH1, BTB and CNC Homolog 1, HA2303) (MaxLight 750)

Sign In for Pricing
View Details
BACH1 (Transcription Regulator Protein BACH1, BTB and CNC Homolog 1, HA2303) (MaxLight 750)
MBS6231732-02 5x 0.1 mL

BACH1 (Transcription Regulator Protein BACH1, BTB and CNC Homolog 1, HA2303) (MaxLight 750)

Sign In for Pricing
View Details
DEF6 (h) -PR
sc-105283-PR 10 µM - 20 µL

DEF6 (h) -PR

Sign In for Pricing
View Details
D-amino acid oxidase activator Polyclonal Antibody
MBS9415103-01 0.1 mg

D-amino acid oxidase activator Polyclonal Antibody

Sign In for Pricing
View Details
D-amino acid oxidase activator Polyclonal Antibody
MBS9415103-02 5x 0.1 mg

D-amino acid oxidase activator Polyclonal Antibody

Sign In for Pricing
View Details