Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cat Cannabinoid receptor 1 (CNR1)

This Recombinant Cat Cannabinoid receptor 1 (CNR1) spans the amino acid sequence from region 1-472.

Product Specifications

Product Name Alternative

Cannabinoid receptor 1, CB-R, CB1

UniProt

O02777

Expression Region

1-472

Origin

Felis catus (Cat) (Felis silvestris catus)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQE KMTAGDNSQLVPADQVNITEFYNKSLSSYKENEENIQCGENFMDMECFMILNPSQQLAIA VLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFVDFHVF HRKDSPNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKKIVTRPKAVVAFCLM WTIAIVIAVLPLLGWNCKKLQSVCSDIFPLIDETYLMFWIGVTSVLLLFIVYAYMYILWK AHIHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPLL AIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTAQ PLDNSMGDSDCLHKHANNTANVHRAAENCIKNTVQIAKVTISVSTNTSAKAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDC42 (NM_001791) Human Over-expression Lysate
LY400679 100 µg

CDC42 (NM_001791) Human Over-expression Lysate

Sign In for Pricing
View Details
ARID3B Human Gene Knockout Kit (CRISPR)
KN206328RB 1 Kit

ARID3B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human GSTα1 (Glutathione S Transferase Alpha 1) CLIA Kit
E-CL-H0872-01 24 Tests

Human GSTα1 (Glutathione S Transferase Alpha 1) CLIA Kit

Sign In for Pricing
View Details
Human GSTα1 (Glutathione S Transferase Alpha 1) CLIA Kit
E-CL-H0872-02 48 Tests

Human GSTα1 (Glutathione S Transferase Alpha 1) CLIA Kit

Sign In for Pricing
View Details
Human GSTα1 (Glutathione S Transferase Alpha 1) CLIA Kit
E-CL-H0872-03 96 Tests

Human GSTα1 (Glutathione S Transferase Alpha 1) CLIA Kit

Sign In for Pricing
View Details
Phosphoenolpyruvate Carboxylase Microplate Assay Kit
RDSM076 100 Assays

Phosphoenolpyruvate Carboxylase Microplate Assay Kit

Sign In for Pricing
View Details