Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 8B (Tmem8b)

This Recombinant Mouse Transmembrane protein 8B (Tmem8b) spans the amino acid sequence from region 1-472.

Product Specifications

Product Name Alternative

Transmembrane protein 8B, Protein NGX6

UniProt

B1AWJ5

Expression Region

1-472

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNMPQSLGTQPLPPEPPSLGTPIEGSGAIAPTEHCWPVRPTLRNELDTFSVHFYIFFGPS VALPPERPAVFALRLLPVLDSGGVLSLELQLNASSLRQENVTVFGCLTHEVPLSLGDAAV TCSKESLAGFLLSVSATSRVARLRIPFPQTGTWFLTLRSLCGVGPRFVRCRNATAEVRLR TFLSPCVDDCGPYGQCKLLRTHNYLYAACECKAGWRGWGCTDSADALTYGFQLLSTLLLC LSNLMFLPPVVLAIRSRYVLEAAVYTFTMFFSTFYHACDQPGIVVFCIMDYDVLQFCDFL GSLMSVWVTVIAMARLQPVIKQVLYLLGAMLLSMALQLDRHGLWNLLGPSLFALGILATA WTVRSVRRRHCYPPTWRRWLFYLCPGSLIAGSAVLLYAFVETRDNYFYIHSIWHMLIAGS VGFLLPPRAKTDRRVPSGARARGCGYQLCINEQEELGLVGPGGTTVSSICVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CWF19L1 Rabbit Polyclonal Antibody
TA365705 100 µL

CWF19L1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Thyroid gland
CS803870 5x 5 µm

Tissue FFPE Sections, Thyroid gland

Sign In for Pricing
View Details
Uromucoid (UMOD) (NM_003361) Human Recombinant Protein
TP323787 20 µg

Uromucoid (UMOD) (NM_003361) Human Recombinant Protein

Sign In for Pricing
View Details
beta II Tubulin (TUBB2A) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3E6]
TA506590BM 100 µL

beta II Tubulin (TUBB2A) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3E6]

Sign In for Pricing
View Details
GPR176 Rabbit Polyclonal Antibody
TA368443 100 µL

GPR176 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Trmt12 Mouse Gene Knockout Kit (CRISPR)
KN518262 1 Kit

Trmt12 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details