Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 8B (Tmem8b)

This Recombinant Mouse Transmembrane protein 8B (Tmem8b) spans the amino acid sequence from region 1-472.

Product Specifications

Product Name Alternative

Transmembrane protein 8B, Protein NGX6

UniProt

B1AWJ5

Expression Region

1-472

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNMPQSLGTQPLPPEPPSLGTPIEGSGAIAPTEHCWPVRPTLRNELDTFSVHFYIFFGPS VALPPERPAVFALRLLPVLDSGGVLSLELQLNASSLRQENVTVFGCLTHEVPLSLGDAAV TCSKESLAGFLLSVSATSRVARLRIPFPQTGTWFLTLRSLCGVGPRFVRCRNATAEVRLR TFLSPCVDDCGPYGQCKLLRTHNYLYAACECKAGWRGWGCTDSADALTYGFQLLSTLLLC LSNLMFLPPVVLAIRSRYVLEAAVYTFTMFFSTFYHACDQPGIVVFCIMDYDVLQFCDFL GSLMSVWVTVIAMARLQPVIKQVLYLLGAMLLSMALQLDRHGLWNLLGPSLFALGILATA WTVRSVRRRHCYPPTWRRWLFYLCPGSLIAGSAVLLYAFVETRDNYFYIHSIWHMLIAGS VGFLLPPRAKTDRRVPSGARARGCGYQLCINEQEELGLVGPGGTTVSSICVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Lymphoid tissue
CS622351 5x 5 µm

Frozen Tissue Sections, Lymphoid tissue

Sign In for Pricing
View Details
Ly-76 / TER-119 Rat Monoclonal Antibody [Clone ID: TER-119]
AM31858BT-N 100 µg

Ly-76 / TER-119 Rat Monoclonal Antibody [Clone ID: TER-119]

Sign In for Pricing
View Details
TRITC Conjugated Limax flavus Lectin (Garden Slug) -LFA-
R-5101-1 1 mg

TRITC Conjugated Limax flavus Lectin (Garden Slug) -LFA-

Sign In for Pricing
View Details
Apg12 (ATG12) (NM_004707) Human Over-expression Lysate
LC401486 20 µg

Apg12 (ATG12) (NM_004707) Human Over-expression Lysate

Sign In for Pricing
View Details
CD49b (ITGA2) (C-term) Rabbit Polyclonal Antibody
AP52250PU-N 400 µL

CD49b (ITGA2) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TIMP1 (Colorectal and Lymph Node Metastasis Marker) (TIMP1/1944R), Biotin conjugate, 0.1mg/mL
BNCB1944-500 1x 500 µL

TIMP1 (Colorectal and Lymph Node Metastasis Marker) (TIMP1/1944R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details