Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Taricha granulosa Cannabinoid receptor 1 (CNR1)

This Recombinant Taricha granulosa Cannabinoid receptor 1 (CNR1) spans the amino acid sequence from region 1-473.

Product Specifications

Product Name Alternative

Cannabinoid receptor 1, CB-R, CB1

UniProt

Q9PUI7

Expression Region

1-473

Origin

Taricha granulosa (Roughskin newt)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKSILDGLADTTFRTITTDLLYMGSNDVQYEDTKGEMASKLGYFPQKLPLSSFRRDHSPD KMTIGDDNLLSFYPLDQFNVTEFFNRSVSTFKENDDNLKCGENFMDMECFMILTASQQLI IAVLSLTLGTFTVLENFLVLCVILQSRTLRCRPSYHFIGSLAVADLLGSVIFVYSFLDFH VFHRKDSSNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRTKAVIAFC VMWTIAIIIAVLPLLGWNCKKLKSVCSDIFPLIDENYLMFWIGVTSILLLFIVYAYVYIL WKAHSHAVRMLQRGTQKSIIIHTSEDGKVQITRPEQTRMDIRLAKTLVLILVVLIICWGP LLAIMVYDVFGKMNNPIKTVFAFCSMLCLMDSTVNPIIYALRSQDLRHAFLEQCPPCEGT SQPLDNSMESDCQHRHGNNAGNVHRAAENCIKSTVKIAKVTMSVSTETSGEAV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (VU-1D9), CF405S conjugate, 0.1mg/mL
BNC040017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF640R conjugate, 0.1mg/mL
BNC401073-100 1x 100 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF568 conjugate, 0.1mg/mL
BNC680026-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TRAcP (Tartrate-Resistant Acid Phosphatase) (Hairy Cell Leukemia Marker) (rACP5/1070), CF405S conjugate, 0.1mg/mL
BNC042337-100 1x 100 µL

TRAcP (Tartrate-Resistant Acid Phosphatase) (Hairy Cell Leukemia Marker) (rACP5/1070), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF770 conjugate, 0.1mg/mL
BNC700164-500 1x 500 µL

CD28 (204.12), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG4 (Ig Heavy Constant Gamma 4) (G4m Marker) (IGHG4/2042R), CF568 conjugate, 0.1mg/mL
BNC682042-500 1x 500 µL

Human IgG4 (Ig Heavy Constant Gamma 4) (G4m Marker) (IGHG4/2042R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details