Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog Beta-1 adrenergic receptor (ADRB1)

This Recombinant Dog Beta-1 adrenergic receptor (ADRB1) spans the amino acid sequence from region 1-473.

Product Specifications

Product Name Alternative

Beta-1 adrenergic receptor, Beta-1 adrenoreceptor, Beta-1 adrenoceptor

UniProt

P79148

Expression Region

1-473

Origin

Canis familiaris (Dog) (Canis lupus familiaris)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGAGALALGASEPCNLSSAAPLPDGAATAARLLVPASPSASPLAPTSEGPAPLSQQWTAG IGLLMALIVLLIVAGNVLVIAAIAKTPRLQTLTNLFIMSLASADLVMGLLVVPFGATIVM RGRWEYGSFLCELWTSVDVLCVTASIETLCVIALDRYLAITAPFRYQSLLTRARARALVC TVWAISALVSFLPILMHWWRAGGDEARRCYNDPKCCDFVTNRAYAIASSVVSFYVPLCIM AFVYLRVFREAQKQVKKIDSCERRFLGGPARPPAPPPAPAPAPPPAPGSPRPAAAAPLAN GRVGRRRPSRLVALREQKALKTLGIIMGVFTLCWLPFFLANVVKAFHRDLVPDRLFVFFN WLGYANSAFNPIIYCRSPDFRRAFQRLLCCARRAARGSHGAAGDPPRARPPPSPGAASDD DDDDEDDAGAGAGAAPPARLLEPWAGCNGGAAADSDSSLDGAGSPAGASESRV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Complement C4d (C4D204), CF740 conjugate, 0.1mg/mL
BNC740204-500 1x 500 µL

Complement C4d (C4D204), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF568 conjugate, 0.1mg/mL
BNC680003-500 1x 500 µL

CD45RO (UCHL-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF543 conjugate, 0.1mg/mL
BNC431050-500 1x 500 µL

CD3e (CRIS-7), CF543 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), CF647 conjugate, 0.1mg/mL
BNC470861-500 1x 500 µL

HSP27 (G3.1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/1484), CF405S conjugate, 0.1mg/mL
BNC041484-100 1x 100 µL

DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/1484), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Hepatocyte Specific (CPS1/1022), CF594 conjugate, 0.1mg/mL
BNC941022-100 1x 100 µL

Hepatocyte Specific (CPS1/1022), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details