Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cricetulus griseus Phosphatidylserine synthase 2 (PTDSS2)

This Recombinant Cricetulus griseus Phosphatidylserine synthase 2 (PTDSS2) spans the amino acid sequence from region 1-474.

Product Specifications

Product Name Alternative

Phosphatidylserine synthase 2, PSS-2, PtdSer synthase 2, EC= 2.7.8.29, Serine-exchange enzyme II

UniProt

O08888

Expression Region

1-474

Origin

Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRRAERRVAGGSGSGSPLLEGRRSTESEVYDDGTNTFFWRAHTLTVLFILTCSLGYVTLL EETPQDTAYNTKRGIVASILVFLCFGVTQAKDGPFSRPHPAYWRFWLCVSVVYELFLIFI LFQTVQDGRQFLKYVDPRLGVPLPERDYGGNCLIYDADNKTDPFHNIWDKLDGFVPAHFI GWYLKTLMIRDWWMCMIISVMFEFLEYSLEHQLPNFSECWWDHWIMDVLICNGLGIYCGM KTLEWLSLKTYKWQGLWNIPTYKGKMKRIAFQFTPYSWVRFEWKPASSLHRWLAVCGIIL VFLLAELNTFYLKFVLWMPPEHYLVLLRLVFFVNVGGVAMREIYDFMDELKPHRKLGQQA WLVAAITVTELLIVVKYDPHTLTLSLPFYISQCWTLGSILVLTWTVWRFFLRDITMRYKE TRRQKQQSHQGRAINNGDGHPGPDDDLLGTGTAEEEGSTNDSVPAEKEGASAAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SRP54 (C-term) Rabbit Polyclonal Antibody
AP54045PU-N 400 µL

SRP54 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SARS-CoV-2 Spike RBD Protein, His Tag (BA.2.12.1/Omicron) (MALS verified)
SPD-C522q-100ug 100 µg

SARS-CoV-2 Spike RBD Protein, His Tag (BA.2.12.1/Omicron) (MALS verified)

Sign In for Pricing
View Details
Topoisomerase (DNA) I, Mitochondrial (TOP1MT) (TOP1MT/568), CF568 conjugate, 0.1mg/mL
BNC680489-100 1x 100 µL

Topoisomerase (DNA) I, Mitochondrial (TOP1MT) (TOP1MT/568), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Apol7a Mouse Gene Knockout Kit (CRISPR)
KN501429 1 Kit

Apol7a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Thyroid Hormone Receptor alpha (THRA) Mouse Monoclonal Antibody [Clone ID: OTI5E12]
CF805258 100 µg

Thyroid Hormone Receptor alpha (THRA) Mouse Monoclonal Antibody [Clone ID: OTI5E12]

Sign In for Pricing
View Details
FRMPD4 Human Gene Knockout Kit (CRISPR)
KN415568 1 Kit

FRMPD4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details