Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Guinea pig C3a anaphylatoxin chemotactic receptor (C3AR1)

This Recombinant Guinea pig C3a anaphylatoxin chemotactic receptor (C3AR1) spans the amino acid sequence from region 1-475.

Product Specifications

Product Name Alternative

C3a anaphylatoxin chemotactic receptor, C3AR, C3a-R

UniProt

O88680

Expression Region

1-475

Origin

Cavia porcellus (Guinea pig)

Field of Research

Neuroscience; Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MESSSAETNSTGLHLEPQYQPETILAMAILGLTFVLGLPGNGLVLWVAGLKMRRTVNTVW FLHLTVADFVCCLSLPFSMAHLALRGYWPYGEILCKFIPTVIIFNMFASVFLLTAISLDR CLMVLKPIWCQNHRNVRTACIICGCIWLVAFVLCIPVFVYRETFTLENHTICTYNFSPGS FDYLDYAYDRDAWGYGTPDPIVQLPGEMEHRSDPSSFQTQDGPWSVTTTLYSQTSQRPSE DSFHMDSAKLSGQGKYVDVVLPTNLCGLPMEENRTNTLHNAAFLSSDLDVSNATQKCLST PEPPQDFWDDLSPFTHEYRTPRLLKVITFTRLVVGFLLPMIIMVACYTLIIFRMRRVRVV KSWNKALHLAMVVVTIFLICWAPYHVFGVLILFINPESRVGAALLSWDHVSIALASANSC FNPFLYALLGRDLRKRVRQSMKGILEAAFSEDISKSTSFIQAKAFSEKHSLSTNV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin, HMW (AE-3), CF405S conjugate, 0.1mg/mL
BNC040257-500 1x 500 µL

Cytokeratin, HMW (AE-3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF740 conjugate, 0.1mg/mL
BNC740204-100 1x 100 µL

Complement C4d (C4D204), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF405M conjugate, 0.1mg/mL
BNC050322-100 1x 100 µL

CD3e (RIV9), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF488A conjugate, 0.1mg/mL
BNC880003-500 1x 500 µL

CD45RO (UCHL-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (58M1), CF405S conjugate, 0.1mg/mL
BNC041003-500 1x 500 µL

Mucin 5AC (MUC5AC) (58M1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF405S conjugate, 0.1mg/mL
BNC040160-500 1x 500 µL

CD20 (B9E9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details