Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Pituitary adenylate cyclase-activating polypeptide type I receptor (ADCYAP1R1)

This Recombinant Bovine Pituitary adenylate cyclase-activating polypeptide type I receptor (ADCYAP1R1) spans the amino acid sequence from region 38-513.

Product Specifications

Product Name Alternative

Pituitary adenylate cyclase-activating polypeptide type I receptor, PACAP type I receptor, PACAP-R-1, PACAP-R1

UniProt

Q29627

Expression Region

38-513

Origin

Bos taurus (Bovine)

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHSDCIFKKEQAMCLEKIQRVNDLMGLNDSSPGCPGMWDNITCWKPAHVGEMVLVSCPEL FRIFNPDQVWETETIGEFGFADSKSLDLSDMRVVSRNCTEDGWSEPFPHYFDACGFEEYE SETGDQDYYYLSVKALYTVGYSTSLVTLTTAMVILCRFRKLHCTRNFIHMNLFVSFMLRA ISVFIKDWILYAEQDSNHCFVSTVECKAVMVFFHYCVVSNYFWLFIEGLYLFTLLVETFF PERRYFYWYIIIGWGTPTVCVSVWAMLRLYFDDTGCWDMNDNTALWWVIKGPVVGSIMVN FVLFIGIIVILVQKLQSPDMGGNESSIYFSCVQKCYCKPQRAQQHSCKMSELSTITLRLA RSTLLLIPLFGIHYTVFAFSPENVSKRERLVFELGLGSFQGFVVAVLYCFLNGEVQAEIK RKWRSWKVNRYFTMDFKHRHPSLASSGVNGGTQLSILSKSSSQIRMSGLPADNLAT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Frk Antibody (OTI6D2) [CoraFluor 1]
NBP2-70775CL1 0.1 mL

Mouse Monoclonal Frk Antibody (OTI6D2) [CoraFluor 1]

Sign In for Pricing
View Details
Interleukin 1 alpha (IL-1a) (MaxLight 750)
MBS6482334-01 0.1 mL

Interleukin 1 alpha (IL-1a) (MaxLight 750)

Sign In for Pricing
View Details
Interleukin 1 alpha (IL-1a) (MaxLight 750)
MBS6482334-02 5x 0.1 mL

Interleukin 1 alpha (IL-1a) (MaxLight 750)

Sign In for Pricing
View Details
Rabbit Polyclonal Cytokeratin 10 Antibody [DyLight 650]
NBP2-99090C 0.1 mL

Rabbit Polyclonal Cytokeratin 10 Antibody [DyLight 650]

Sign In for Pricing
View Details
pTAL1 Plasmid
PVT38618 2 µg

pTAL1 Plasmid

Sign In for Pricing
View Details
Sheep Anti-Dopachrome Tautomerase antibody ELISA kit
GTR10401212 96 Well

Sheep Anti-Dopachrome Tautomerase antibody ELISA kit

Sign In for Pricing
View Details