Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Pituitary adenylate cyclase-activating polypeptide type I receptor (Adcyap1r1)

This Recombinant Mouse Pituitary adenylate cyclase-activating polypeptide type I receptor (Adcyap1r1) spans the amino acid sequence from region 21-496.

Product Specifications

Product Name Alternative

Pituitary adenylate cyclase-activating polypeptide type I receptor, PACAP type I receptor, PACAP-R-1, PACAP-R1

UniProt

P70205

Expression Region

21-496

Origin

Mus musculus (Mouse)

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHSDCIFKKEQAMCLERIQRANDLMGLNESSPGCPGMWDNITCWKPAQIGEMVLVSCPEV FRIFNPDQVWMTETIGDSGFADSNSLEITDMGVVGRNCTEDGWSEPFPHYFDACGFDDYE PESGDQDYYYLSVKALYTVGYSTSLVTLTTAMVILCRFRKLHCTRNFIHMNLFVSFMLRA ISVFIKDWILYAEQDSSHCFVSTVECKAVMVFFHYCVVSNYFWLFIEGLYLFTLLVETFF PERRYFYWYTIIGWGTPTVCVTVWAVLRLYFDDAGCWDMNDSTALWWVIKGPVVGSIMVN FVLFIGIIIILVQKLQSPDMGGNESSIYFSCVQKCYCKPQRAQQHSCKMSELSTITLRLA RSTLLLIPLFGIHYTVFAFSPENVSKRERLVFELGLGSFQGFVVAVLYCFLNGEVQAEIK RKWRSWKVNRYFTMDFKHRHPSLASSGVNGGTQLSILSKSSSQLRMSSLPADNLAT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Acidic Xylanase Microplate Assay Kit
RDSM090 100 Assays

Acidic Xylanase Microplate Assay Kit

Sign In for Pricing
View Details
IFI16 Antibody
KC-27423-01 50 μL

IFI16 Antibody

Sign In for Pricing
View Details
IFI16 Antibody
KC-27423-02 100 µL

IFI16 Antibody

Sign In for Pricing
View Details
IFI16 Antibody
KC-27423-03 1 mL

IFI16 Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon: right
CS644043 5x 5 µm

Frozen Tissue Sections, Colon: right

Sign In for Pricing
View Details
Human SH3 Domain Binding Glutamic Acid Rich Protein Like Protein (SH3BGRL) ELISA Kit
RDR-SH3BGRL-Hu-01 96 Tests

Human SH3 Domain Binding Glutamic Acid Rich Protein Like Protein (SH3BGRL) ELISA Kit

Sign In for Pricing
View Details