Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus laevis Transmembrane protein 39B (tmem39b)

This Recombinant Xenopus laevis Transmembrane protein 39B (tmem39b) spans the amino acid sequence from region 1-477.

Product Specifications

Product Name Alternative

Transmembrane protein 39B

UniProt

Q6NRI4

Expression Region

1-477

Origin

Xenopus laevis (African clawed frog)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGGRRGPNRTSYCRTPLCDPGSAGGAAHGGMPSVGGVRSRARSSSSTGLSSPPLAAQTV VPLRHCKIPDLPADRHLLFELQLFFCHLIALFVHYINIYKTVWWYPPSHPPSHTSLNFHL IDFNVLTLTTIVLARRLIGAIVREASQGGKSSMPQSLLLVATRFAVLTGTGWSFCRSIIL LFRTHSFFNLLFLCYPFGMYIPFLQLGWDFRRPGLSHMPNTRDLASMDRGSKDYLHVLQH ILRHHMPSAEPLPTHACCLSPDLIRSEVHYLKLDFNWRVREVLLSSMLSAYYVAFVPVWF VKSTQYYDKCWSCELFLQVSLSTSVILTQHLLPAQYCDLLHKAAAHLGCWQKVDPALCSN MLQHSWMEECMWPQGVLVKHNKNVYKAVGHYNVAIPSDVSHFRFHFFFSNPLRVLNILTT LEGVLIFYQLYSLLSSEKWHHTISLALILFGNYYAFFKLLRDRIVLGKAYSYTAVPD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45RO (UCHL-1), CF594 conjugate, 0.1mg/mL
BNC940003-100 1x 100 µL

CD45RO (UCHL-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF488A conjugate, 0.1mg/mL
BNC880333-100 1x 100 µL

CD8 (RIV11), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF405S conjugate, 0.1mg/mL
BNC040965-100 1x 100 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (LK1), CF568 conjugate, 0.1mg/mL
BNC680851-100 1x 100 µL

HSP60 (LK1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (T311), CF640R conjugate, 0.1mg/mL
BNC400012-100 1x 100 µL

Tyrosinase (T311), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF405S conjugate, 0.1mg/mL
BNC040745-100 1x 100 µL

CD45 / LCA (2B11 + PD7/26), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details