Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii C3a anaphylatoxin chemotactic receptor (C3AR1)

This Recombinant Pongo abelii C3a anaphylatoxin chemotactic receptor (C3AR1) spans the amino acid sequence from region 1-482.

Product Specifications

Product Name Alternative

C3a anaphylatoxin chemotactic receptor, C3AR, C3a-R

UniProt

Q5REI5

Expression Region

1-482

Origin

Pongo abelii (Sumatran orangutan)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASFSAETNSTDLLSQPWNEPPVILSMVILSLTFLLGLPGNGLVLWVAGLKMQRTVNTVW FLHLTLADLLCCLSLPFSLAHLALQGQWPYGRFLCELIPSIIVLNMFASVFLLTAISLDR CLVVFKPIWCQNHRNVGTACSICGCIWVVAFVMCIPVFVYREIFTADNHNRCGYKFGLSS SLDYPDFYGDPLENRSLENIVQLPGEMNDRLDPSSFQTNDHPWTVPTVFQPQTFQRPSAD SLHRDSARLTSQNLYSNVFKPADVVSPKIPSGFPIKDQETSPLDNSDAFLSTHLKLFPSA SSNSFYESELPQDFQDYYNLGQFEDDNQVPTPLVAITITRLVVGFLLPSVIMIACYSFIV FRMQRGRFAKSQSKTFRVAVVVVAVFLVCWTPYHIFGVLSLLIDPESPLGKTLMSWDHVS IALASANSCFNPFLYALLGKDFRKKARQSIQGILEAAFSEELTRSTHCNSNNVFSERNST TV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 17 (E3), CF405S conjugate, 0.1mg/mL
BNC040158-500 1x 500 µL

Cytokeratin 17 (E3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF488A conjugate, 0.1mg/mL
BNC880009-500 1x 500 µL

MART-1 / Melan-A (M2-7C10), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF594 conjugate, 0.1mg/mL
BNC940333-500 1x 500 µL

CD8 (RIV11), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF740 conjugate, 0.1mg/mL
BNC740745-500 1x 500 µL

CD45 / LCA (2B11 + PD7/26), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 10 (Suprabasal Epithelial Marker) (KRT10/1948R), CF488A conjugate, 0.1mg/mL
BNC881948-500 1x 500 µL

Cytokeratin 10 (Suprabasal Epithelial Marker) (KRT10/1948R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2959), CF640R conjugate, 0.1mg/mL
BNC402959-500 1x 500 µL

Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2959), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details