Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Probable G-protein coupled receptor 152 (Gpr152)

This Recombinant Mouse Probable G-protein coupled receptor 152 (Gpr152) spans the amino acid sequence from region 1-511.

Product Specifications

Product Name Alternative

Probable G-protein coupled receptor 152

UniProt

Q8BXS7

Expression Region

1-511

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDTAVEANLGAAGHGPRTELSDEDYYPQGSWDTVFLVALLLLGLPANGLMAWLAGSQARH GAGTRLALLLLSLALSDFLFLAAATFQILEIQHGGHWPLGTAACRFYYFLWGVSYSSGLF LLTALSLDRCLLALCPRWYPGHRPARLPLWVCAGVWVLATLFSVPWLVFPEAAVWWYDLV ICLDFWDTEELPLRMLEILGGFLPFLLLLVCHVLTQATACRTCCGHQPRRMACHGFARVA KTILSAYVVLRLPYQLAQLLYLAFLWDVYPGYLLWEALVYSDYLILLNSCLSPFLCLAAS ADLRALLRTVLSSFAAAVCEERPGSFIPAEPQTLPGPTSEGQSRLDSVVQPQVNPSVQLQ SDSVVQPEVSPSAQPQSDSVAQPTVGSLIQPPLDTVVQLEVNPLTQPQLDPMAQPQVNPS AQPQSKSVVQPQVDPLTQPQLDPVAQPQSNTETPIPAFGDESASNPGEENSSGPCPDPTP GTPENLDRPAVPQEKSPSNVPPEEAPSAGPT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elab Fluor® Violet 610 Anti-Mouse CD4 Antibody[GK1.5]
E-AB-F1097T-01 50 Tests

Elab Fluor® Violet 610 Anti-Mouse CD4 Antibody[GK1.5]

Sign In for Pricing
View Details
Elab Fluor® Violet 610 Anti-Mouse CD4 Antibody[GK1.5]
E-AB-F1097T-02 100 Tests

Elab Fluor® Violet 610 Anti-Mouse CD4 Antibody[GK1.5]

Sign In for Pricing
View Details
Elab Fluor® Violet 610 Anti-Mouse CD4 Antibody[GK1.5]
E-AB-F1097T-03 2x 100 Tests

Elab Fluor® Violet 610 Anti-Mouse CD4 Antibody[GK1.5]

Sign In for Pricing
View Details
Mouse NGAL (Neutrophil Gelatinase Associated Lipocalin) ELISA Kit
E-EL-M0828-01 24 Tests

Mouse NGAL (Neutrophil Gelatinase Associated Lipocalin) ELISA Kit

Sign In for Pricing
View Details
Mouse NGAL (Neutrophil Gelatinase Associated Lipocalin) ELISA Kit
E-EL-M0828-02 48 Tests

Mouse NGAL (Neutrophil Gelatinase Associated Lipocalin) ELISA Kit

Sign In for Pricing
View Details
Mouse NGAL (Neutrophil Gelatinase Associated Lipocalin) ELISA Kit
E-EL-M0828-03 96 Tests

Mouse NGAL (Neutrophil Gelatinase Associated Lipocalin) ELISA Kit

Sign In for Pricing
View Details