Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum UPF0053 protein BU323 (BU323)

This Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum UPF0053 protein BU323 (BU323) spans the amino acid sequence from region 1-521.

Product Specifications

Product Name Alternative

UPF0053 protein BU323

UniProt

P57408

Expression Region

1-521

Origin

Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) (Acyrthosiphon pisum symbiotic bacterium)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEFFLDPSTWAGLLTLVILEVVLGIDNLIFVAILSEKLPPNQRDKARLIGLGLALVMRLA LLSLISWIVTLNSPIVHNKFFSLSIRDIILLFGGFFLLFKTTMELHERLENNHHENSENK NYAGFWAVVIQIVVLDAVFSLDAIITAVGMVNQLLIMMIAVILATFLMLLASKALTNFIN LHQTVVVLCLSFLLMIGFSLVTEALRFCIPKGYLYAAIGFSILIEIFNQIARHNFMKNQS RRPMRQRAAEAILRLMVGEQNKKQQIKKIEINSQKTDSIQSSKEMETFKDEERYMINGVL TLAGRSIRSIMTPRSNISWVNTEKNTDEIRMQLLDTPHSLFPVCKGELDEIIGIVRAKEL LVAIEKKIDASTFSSKILPIIIPDTLDPIKLLGVLRRAQGSFVIVSNEFGVVQGLITPLD VLEAIAGEFPDADETPDIIQENNSWLVKGETDLHSLQQLLNTEELIKEDNYASLGGLLIA QKGQLPIPGEIIHIHPFYFHIVKATEYRIDLVRIIKNQDDN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44 Standard (156-3C11), CF568 conjugate, 0.1mg/mL
BNC680460-500 1x 500 µL

CD44 Standard (156-3C11), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF405S conjugate, 0.1mg/mL
BNC040630-500 1x 500 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF640R conjugate, 0.1mg/mL
BNC400806-100 1x 100 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (58M1), CF568 conjugate, 0.1mg/mL
BNC681003-500 1x 500 µL

Mucin 5AC (MUC5AC) (58M1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 16 (KRT16) (Suprabasal Keratinocyte Marker) (LL025), CF405S conjugate, 0.1mg/mL
BNC041692-500 1x 500 µL

Cytokeratin 16 (KRT16) (Suprabasal Keratinocyte Marker) (LL025), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Myosin, Smooth Muscle Heavy Chain (MYH11/923), CF488A conjugate, 0.1mg/mL
BNC880923-500 1x 500 µL

Myosin, Smooth Muscle Heavy Chain (MYH11/923), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details