Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Parathyroid hormone 2 receptor (Pth2r)

This Recombinant Mouse Parathyroid hormone 2 receptor (Pth2r) spans the amino acid sequence from region 25-546.

Product Specifications

Product Name Alternative

Parathyroid hormone 2 receptor, PTH2 receptor

UniProt

Q91V95

Expression Region

25-546

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

QLDSDGTITIEEQIVLVMKAKMQCELNITAQLQEGEGNCFPEWDGIICWPRGTVGKMSAV PCPPYVYDFNHKGVAFRHCTPNGTWDSIHGSNKTWANYSDCFLQPDINIGKQEFFESLYI LYTVGYSISFGSLAVAILIIGYFRRLHCTRNYIHLHLFVSFMLRAMSIFVKDRVAQAHLG VEALQSLVMQGDLQNFIGGPSVDKSQYVGCKIAVVMFIYFLATNYYWILVEGLYLHNLIF VSFFSDTKYLWGFISIGWGFPAVFVVAWAVARATLADTRCWELSAGDRWIYQAPILAAIG LNFILFLNTVRVLATKIWETNAVGHDMRKQYRKLAKSTLVLVLVFGVHYIVFVCQPHSFS GLWWEIRMHCELFFNSFQGFFVSIVYCYCNGEVQAEVKKMWTRWNLSIDWKRAPPCGGQR YGSVLTTVTHSTSSQSQMGASTRLVLISGKPTKNACRQIDSHVTLPGYVWSSSEQDCQTH SPPEETKEGHRRQGDDSPVMESSRPVAFTLDTEGCKGETHPI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPFIBP2 (PTPRF Interacting Protein, Binding Protein 2 (liprin beta 2), Cclp1, DKFZp781K06126, MGC42541)
250348 50 µL

PPFIBP2 (PTPRF Interacting Protein, Binding Protein 2 (liprin beta 2), Cclp1, DKFZp781K06126, MGC42541)

Sign In for Pricing
View Details
PR Domain Zinc Finger Protein 5 (PRDM5) Antibody
abx122634-01 100 µg

PR Domain Zinc Finger Protein 5 (PRDM5) Antibody

Sign In for Pricing
View Details
PR Domain Zinc Finger Protein 5 (PRDM5) Antibody
abx122634-02 1 mg

PR Domain Zinc Finger Protein 5 (PRDM5) Antibody

Sign In for Pricing
View Details
PAX8 (Renal Cell Marker) (PAX8/1491 + PAX8/1492), CF640R conjugate, 0.1mg/mL
BNC401703-100 1x 100 µL

PAX8 (Renal Cell Marker) (PAX8/1491 + PAX8/1492), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MFAP2 Rabbit Polyclonal Antibody
MBS9513087-01 0.05 mL

MFAP2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MFAP2 Rabbit Polyclonal Antibody
MBS9513087-02 0.1 mL

MFAP2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details