Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable G-protein coupled receptor 97 (GPR97)

This Recombinant Human Probable G-protein coupled receptor 97 (GPR97) spans the amino acid sequence from region 21-549.

Product Specifications

Product Name Alternative

Probable G-protein coupled receptor 97, G-protein coupled receptor PGR26

UniProt

Q86Y34

Expression Region

21-549

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

QEKPTEGPRNTCLGSNNMYDIFNLNDKALCFTKCRQSGSDSCNVENLQRYWLNYEAHLMK EGLTQKVNTPFLKALVQNLSTNTAEDFYFSLEPSQVPRQVMKDEDKPPDRVRLPKSLFRS LPGNRSVVRLAVTILDIGPGTLFKGPRLGLGDGSGVLNNRLVGLSVGQMHVTKLAEPLEI VFSHQRPPPNMTLTCVFWDVTKGTTGDWSSEGCSTEVRPEGTVCCCDHLTFFALLLRPTL DQSTVHILTRISQAGCGVSMIFLAFTIILYAFLRLSRERFKSEDAPKIHVALGGSLFLLN LAFLVNVGSGSKGSDAACWARGAVFHYFLLCAFTWMGLEAFHLYLLAVRVFNTYFGHYFL KLSLVGWGLPALMVIGTGSANSYGLYTIRDRENRTSLELCWFREGTTMYALYITVHGYFL ITFLFGMVVLALVVWKIFTLSRATAVKERGKNRKKVLTLLGLSSLVGVTWGLAIFTPLGL STVYIFALFNSLQGVFICCWFTILYLPSQSTTVSSSTARLDQAHSASQE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

alpha 2a Adrenergic Receptor (ADRA2A) (C-term) Rabbit Polyclonal Antibody
AP23299PU-N 100 µg

alpha 2a Adrenergic Receptor (ADRA2A) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD31 / PECAM-1 (Endothelial Cell Marker) (PECAM1/3526), CF647 conjugate, 0.1mg/mL
BNC473526-500 1x 500 µL

CD31 / PECAM-1 (Endothelial Cell Marker) (PECAM1/3526), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Blocks, Colon: sigmoid
CB618180 1 Block

Frozen Tissue Blocks, Colon: sigmoid

Sign In for Pricing
View Details
Human METTL2A activation kit by CRISPRa
GA117404 1 Kit

Human METTL2A activation kit by CRISPRa

Sign In for Pricing
View Details
Colloidal Gold Conjugated Cicer arietinum Lectin (Chick Pea) -CPA-,  40nm
GP-6601-40 1 mL

Colloidal Gold Conjugated Cicer arietinum Lectin (Chick Pea) -CPA-, 40nm

Sign In for Pricing
View Details
FAM118A (NM_001104595) Human Over-expression Lysate
LC426209 20 µg

FAM118A (NM_001104595) Human Over-expression Lysate

Sign In for Pricing
View Details